SecReT6
Protein ID: 51597549
SecReT6 ID65
T6SS typei2
Gene symbol-
Locus tagYPTB3245
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]3820724..3823072 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ666K9
KEGG IDyps:YPTB3245
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.30E-66, Aligned region: 34..355
DUF2345 [PF10106], Evalue: 6.50E-48, Aligned region: 583..598
DUF2345 [PF10106], Evalue: 6.50E-48, Aligned region: 611..751
T6SS_Vgr [PF13296], Evalue: 6.30E-35, Aligned region: 488..591
T6SS_Vgr [PF13296], Evalue: 6.30E-35, Aligned region: 629..651
Phage_base_V [PF04717], Evalue: 1.00E-15, Aligned region: 390..481
Protein Sequence: 782 a.a.     [Download]
>gi|51597549|ref|YP_071740.1| hypothetical protein YPTB3245 [Yersinia pseudotuberculosis IP 32953]
MNTTLPTLRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATMLMQDASLTLAA
PVAEAFGVTVQQTQRVIQGVVTGFKRLSASKEECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYPS
GLTLQAVPPSGLHDSGTESVWDLSSAHQVVEKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYAD
NYLIVGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALSPGQELKVTGNDVPAQFGKGVIVTRI
TSHARRDRSYEVHFEAIPYSEEYCFRPALIRKPTMAGTLPARVTSTTANDTYGHIDKDGRYRVNLMFDRD
SWESGYESLWVRQARPYAGDTYGLHLPLLAGTEVAIAFEDGNPDRPYIAYVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQSRGEGFELRTDSFGALRAEKGIFITAD
GQAKAQGQVLEMQPAISLLKSAQEQMEAISADAQTATASPANLQVQISLLQQNLTELKQAVLLLSAPKGI
ALSSGEHLQLSASENLIATAGKNADVSVGKNFFIGVGNTLSIFVRKLGIKLIANQGAITVQAQNDLMELL
ARKAITITSTEDEIKITAKKKITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRQEKANKPEDFPSVAP
ETTEPTSHFTFS
 
Nucleotide Sequence: 2349 bp     [Download]
>gi|51594359|ref|NC_006155.1|:c3823072-3820724 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGAATACCACTCTCCCGACTCTTCGGTTTGACCATAGCCACCACAAACTGGTGGTCCGCGACAGCACCG
CCGCCGTTGATGTGTTGGGCTTTGAAGGCCACGAAAGCCTGAGCCAGCCGTTCTGTTACGACATCCAATT
CACCAGCGCCGACAAGGCGATTGACCCGGCCACCATGCTGATGCAGGACGCGTCACTGACATTGGCGGCC
CCGGTGGCCGAAGCTTTTGGCGTGACGGTTCAGCAGACCCAGCGAGTGATCCAAGGGGTGGTCACCGGAT
TTAAACGCCTGTCGGCCTCGAAAGAGGAATGCCGCTACGAACTGAGCCTGCAACCGCGCCTGGCCTTGCT
GTCGCGCAGCCATCAGAACGGGATATATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGATATGCGCGGTCAGGATTTTGTCTTCACCCTGGCCCGCGAGTACCCGCGCCGCGAGCAGG
TGATGCAGTACGGCGAAGATGACCTGACCTTTATCCGCCGCCTGCTGGCGGAAGTGGGGATCTGGTTTCG
TTTTACCGCCGATCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAGCGCTTTTACCCGTCA
GGGCTGACGCTACAGGCAGTGCCCCCTTCGGGCCTGCACGACAGCGGGACGGAGTCGGTCTGGGATTTGT
CCAGTGCCCATCAGGTGGTGGAGAAATCGGTCAGTACCGGTGATTACAACTACCGCACCGCCACTGCCGA
TATGACGGCCGGAGCCGATATCACTCGCGGCGATACCACCACCTACGGCGAAGCCTATCATTACGCCGAT
AACTACCTGATCGTAGGCAGCGAAGGGCGCGAGCCGGAAAGTGAAAGCGGGGCCTTTTATGCCCGCCTGC
GCCATGAACGTTACCTCAATAATCAGGCGCGCTTCGCCGGGGTGGCCAATGCGGCGGCACTGTCACCGGG
TCAGGAACTGAAAGTCACCGGCAACGACGTGCCAGCACAATTTGGCAAAGGGGTGATAGTCACCCGCATC
ACCAGCCACGCCCGCCGCGACCGCAGCTATGAAGTGCATTTTGAAGCCATTCCTTATTCCGAAGAGTATT
GCTTCCGTCCGGCGCTGATCCGCAAGCCGACCATGGCCGGGACCTTGCCGGCGCGGGTGACCAGTACCAC
TGCGAACGACACTTATGGTCATATCGACAAAGACGGGCGCTACCGTGTCAACCTGATGTTCGACCGTGAC
AGTTGGGAGTCGGGTTACGAAAGCTTGTGGGTTCGTCAGGCTCGACCGTATGCGGGTGACACCTACGGCC
TGCACCTGCCGCTGCTGGCCGGCACCGAAGTGGCGATTGCATTTGAGGACGGCAACCCGGACCGGCCGTA
TATCGCCTATGTGCTGCACGACTCGGCGCACGGCGACCACGTCACCATCAGCAACTACAAACGCAACGTA
CTGCGCACTCCGTCGAACAACAAACTGCGCCTGGAGGATGAACGGGGCAAAGAGCACATCAAGCTCAGCA
CCGAATACGGCGGCAAAAGCCAGTTGAATCTGGGGCATCTGGTCGATAACGAGAAACAGTCTCGGGGTGA
GGGTTTTGAGCTGCGCACCGACAGTTTTGGTGCCTTGCGGGCAGAAAAGGGCATTTTTATCACTGCCGAC
GGCCAGGCCAAAGCACAGGGGCAGGTGCTGGAGATGCAACCGGCTATCAGCCTGTTGAAAAGTGCGCAGG
AACAGATGGAGGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCAACCTACAGGTACAAAT
CAGTCTGTTGCAGCAAAATCTCACTGAACTGAAACAAGCTGTCCTGTTACTGAGTGCGCCAAAGGGGATC
GCGTTGAGCAGTGGCGAACATTTACAACTGTCGGCCAGCGAAAATCTGATAGCCACTGCCGGTAAGAATG
CGGATGTCAGTGTAGGTAAGAATTTTTTTATCGGTGTGGGCAACACGCTGAGCATATTTGTACGCAAGCT
GGGGATAAAGTTGATAGCGAATCAGGGAGCAATAACGGTACAGGCCCAGAATGATCTGATGGAGTTATTG
GCGCGTAAAGCGATCACGATCACCAGCACCGAGGATGAGATAAAAATCACCGCCAAGAAGAAGATAACGC
TAAATGCAGGCGGCAGTTATATCACGCTGGATGAGAATCGGATCGAGTCAGGAACGGCGGGGGAATATTT
GACCAAAGCAGGGTATTACGGGCGACAGGAAAAGGCAAATAAACCAGAAGATTTTCCGAGTGTTGCCCCG
GAAACAACAGAACCCACCAGTCATTTCACTTTTTCCTGA