SecReT6
Protein ID: 51597550
SecReT6 ID65
T6SS typei2
Gene symbolclpB3
Locus tagYPTB3246
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]3823069..3825717 [-]
ProductClp ATPase
NoteTssH
UniProt IDQ666K8
KEGG IDyps:YPTB3246
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.40E-40, Aligned region: 237..256
AAA_2 [PF07724], Evalue: 5.40E-40, Aligned region: 611..775
AAA [PF00004], Evalue: 1.40E-19, Aligned region: 239..351
AAA [PF00004], Evalue: 1.40E-19, Aligned region: 616..734
AAA_5 [PF07728], Evalue: 1.90E-14, Aligned region: 239..263
AAA_5 [PF07728], Evalue: 1.90E-14, Aligned region: 336..369
AAA_5 [PF07728], Evalue: 1.90E-14, Aligned region: 615..734
ClpB_D2-small [PF10431], Evalue: 2.20E-13, Aligned region: 782..860
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 143..197
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 216..260
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 284..317
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 471..531
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 588..659
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 680..710
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 753..807
AAA_25 [PF13481], Evalue: 2.00E-08, Aligned region: 239..304
AAA_25 [PF13481], Evalue: 2.00E-08, Aligned region: 293..327
AAA_25 [PF13481], Evalue: 2.00E-08, Aligned region: 613..644
AAA_22 [PF13401], Evalue: 2.10E-08, Aligned region: 62..109
AAA_22 [PF13401], Evalue: 2.10E-08, Aligned region: 238..324
AAA_22 [PF13401], Evalue: 2.10E-08, Aligned region: 614..652
Arch_ATPase [PF01637], Evalue: 4.00E-07, Aligned region: 217..254
Arch_ATPase [PF01637], Evalue: 4.00E-07, Aligned region: 291..391
Arch_ATPase [PF01637], Evalue: 4.00E-07, Aligned region: 608..654
Arch_ATPase [PF01637], Evalue: 4.00E-07, Aligned region: 685..702
IstB_IS21 [PF01695], Evalue: 7.30E-07, Aligned region: 233..300
IstB_IS21 [PF01695], Evalue: 7.30E-07, Aligned region: 615..635
NACHT [PF05729], Evalue: 2.00E-06, Aligned region: 239..325
NACHT [PF05729], Evalue: 2.00E-06, Aligned region: 615..636
Zeta_toxin [PF06414], Evalue: 6.10E-06, Aligned region: 234..263
Zeta_toxin [PF06414], Evalue: 6.10E-06, Aligned region: 448..517
Zeta_toxin [PF06414], Evalue: 6.10E-06, Aligned region: 614..655
AAA_19 [PF13245], Evalue: 1.10E-05, Aligned region: 236..260
AAA_19 [PF13245], Evalue: 1.10E-05, Aligned region: 613..637
AAA_14 [PF13173], Evalue: 1.80E-05, Aligned region: 239..336
AAA_14 [PF13173], Evalue: 1.80E-05, Aligned region: 614..705
AAA_17 [PF13207], Evalue: 2.50E-05, Aligned region: 239..304
AAA_17 [PF13207], Evalue: 2.50E-05, Aligned region: 614..650
AAA_17 [PF13207], Evalue: 2.50E-05, Aligned region: 798..816
Sigma54_activat [PF00158], Evalue: 0.00018, Aligned region: 220..253
Sigma54_activat [PF00158], Evalue: 0.00018, Aligned region: 615..731
Clp_N [PF02861], Evalue: 0.0009, Aligned region: 23..59
Clp_N [PF02861], Evalue: 0.0009, Aligned region: 111..125
Clp_N [PF02861], Evalue: 0.0009, Aligned region: 453..472
RuvB_N [PF05496], Evalue: 0.0017, Aligned region: 237..256
RuvB_N [PF05496], Evalue: 0.0017, Aligned region: 310..319
RuvB_N [PF05496], Evalue: 0.0017, Aligned region: 575..636
AAA_18 [PF13238], Evalue: 0.0024, Aligned region: 239..266
AAA_18 [PF13238], Evalue: 0.0024, Aligned region: 616..645
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 240..261
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 616..637
DUF258 [PF03193], Evalue: 0.0032, Aligned region: 221..257
DUF258 [PF03193], Evalue: 0.0032, Aligned region: 615..629
DUF258 [PF03193], Evalue: 0.0032, Aligned region: 792..834
AAA_33 [PF13671], Evalue: 0.0056, Aligned region: 239..256
AAA_33 [PF13671], Evalue: 0.0056, Aligned region: 614..637
SRP54 [PF00448], Evalue: 0.0084, Aligned region: 239..260
SRP54 [PF00448], Evalue: 0.0084, Aligned region: 614..660
Protein Sequence: 882 a.a.     [Download]
>gi|51597550|ref|YP_071741.1| Clp ATPase [Yersinia pseudotuberculosis IP 32953]
MTTHSAHLLRRLNPYCAQALAGAATLCQTRAHAEITVEHWLLKLLEQGEGDITVIARRYEWDMDSLWQGL
LSHLDTLPRTVQGKPQLSAALQQLIKSAWLDASLQENADAVRSVHLMAALINSPSLLAADAAWPLLSLST
TQLHRLLPLLDSQSDERPEVQQAAALADSPVNLADEAATVTSASGQPQLNDALQAALDKFTLDVTAKARA
NQIDPIFGRDSEIRQMIDILSRRRKNNPILVGEPGVGKTALVEGLALRIADGNVPDSLKTVSVRTLDLGL
LQAGAGVKGEFEQRLKNVIEAVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAAT
TWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKERYATHHGVHILDAAITAAVTLSRRFLTGR
QLPDKAVDLLDTAGARVRMSIDTLPTALMAINAELAALAMEQQAIEQDLLLLPNVSSTRLPEIEQRRAAL
AVGQHTLEQQYKEEKRLTTLIIEARQDIANVAHLVALQEELVQIQGNAPLLSLDVDVRTVAAVIADWTGV
PLGSLLKDEQTNLLSLENRLGERVIGQDAALGALAQRLRAAKTGLTSENGPLGVFLLVGPSGIGKTETAL
ALADSLFGGEKSLITINLSEYQEAHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKAHRDV
LNLFYQVFDRGFMRDGEGREIDFRNTVMVMTANLGSDHLMQLLDEQPDAPDSTLHELLRPILRDHFQPAL
LARFQTLIYRPLNAPALRTIVEMKLAQVANRLKKHYGLHCTLEASLYDTLVAACLLPDTGARNIDSLLNQ
QILPVLSQQLLSRMSEQQRTTSLTLGWDEADGITLEFEGGEK
 
Nucleotide Sequence: 2649 bp     [Download]
>gi|51594359|ref|NC_006155.1|:c3825717-3823069 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGACAACGCATTCAGCACACTTATTACGCCGCTTAAATCCCTATTGCGCACAGGCACTGGCCGGTGCTG
CCACCCTGTGTCAGACCCGCGCCCATGCCGAGATCACTGTCGAACACTGGTTGTTAAAACTGCTGGAGCA
GGGCGAAGGCGATATCACGGTGATTGCCCGGCGTTATGAGTGGGACATGGACAGCCTGTGGCAGGGATTA
CTGTCCCATCTGGACACCTTGCCGCGCACGGTACAGGGCAAACCTCAGTTGTCCGCCGCGTTACAGCAAC
TGATCAAAAGTGCCTGGCTGGATGCCTCGTTGCAGGAAAATGCTGATGCGGTGCGCTCGGTTCATCTAAT
GGCAGCGCTGATAAATTCGCCATCATTATTGGCCGCCGATGCCGCCTGGCCGTTGCTCAGCCTGAGCACT
ACCCAACTACACCGCTTGTTGCCGTTGCTGGACAGCCAATCCGACGAACGTCCTGAGGTGCAGCAGGCTG
CGGCACTGGCCGACAGCCCGGTCAATCTGGCCGATGAGGCCGCGACGGTTACCTCCGCCAGTGGTCAGCC
GCAACTGAATGACGCGCTGCAAGCGGCGCTGGATAAATTTACCCTCGATGTCACCGCTAAAGCCCGTGCC
AACCAGATTGATCCGATTTTTGGCCGCGACAGCGAAATCCGCCAGATGATCGATATCCTGTCGCGCCGCC
GTAAAAACAACCCGATTCTGGTCGGTGAACCGGGCGTCGGTAAAACCGCGCTGGTTGAAGGGCTGGCGCT
ACGTATTGCCGACGGCAACGTACCGGACAGCCTGAAAACCGTCAGTGTGCGCACACTGGATTTGGGTCTG
TTACAGGCCGGGGCTGGGGTCAAAGGCGAATTCGAACAGCGCCTGAAAAATGTTATCGAGGCGGTACAAC
AATCCCCCAGCCCGGTGCTGCTGTTTATCGACGAAGCCCACACCATTATCGGGGCCGGTAATCAGGCCGG
TGGTGCCGATGCGGCTAACCTGCTGAAACCGGCACTGGCGCGTGGCGAACTGCGCACCATCGCCGCCACC
ACCTGGTCCGAATACAAACAGTATTTTGAACGCGATGCCGCACTGGAGCGCCGCTTCCAGATGGTCAAAG
TGGACGAGCCGGATGATGACACCGCCTGCCTGATGCTGCGTGGCCTGAAAGAACGTTACGCCACCCATCA
CGGCGTGCATATTCTGGACGCCGCTATCACCGCAGCGGTTACCCTGTCGCGCCGCTTCCTGACCGGCCGC
CAACTGCCGGACAAAGCGGTGGATCTGCTCGATACCGCCGGTGCCCGGGTGCGCATGAGCATTGACACCT
TGCCGACTGCGCTGATGGCGATTAACGCCGAGCTGGCCGCACTGGCGATGGAGCAACAGGCCATCGAACA
GGACTTGCTCCTGCTGCCGAATGTCAGTTCAACGCGCTTACCTGAGATTGAGCAACGCCGCGCCGCGCTG
GCGGTTGGGCAGCACACACTCGAACAGCAATATAAAGAAGAAAAACGGCTGACCACCCTGATTATCGAGG
CGCGTCAGGATATCGCCAACGTGGCACATCTGGTCGCGTTGCAGGAGGAACTCGTTCAGATCCAAGGCAA
CGCGCCGCTGCTGTCGCTGGACGTTGATGTGCGCACTGTTGCGGCTGTGATCGCCGACTGGACCGGTGTG
CCGCTGGGCAGTTTACTCAAAGACGAACAAACCAACTTGCTGTCACTGGAAAATCGTCTGGGCGAGCGAG
TAATTGGGCAGGATGCGGCATTAGGCGCGCTGGCGCAACGGCTGCGGGCGGCGAAAACCGGCCTGACATC
AGAGAATGGTCCGCTGGGGGTGTTCCTGCTGGTCGGGCCGAGTGGGATCGGCAAAACCGAAACCGCGCTG
GCACTGGCCGACAGCCTGTTCGGCGGCGAGAAATCGCTGATCACCATCAACTTATCGGAGTATCAGGAAG
CACACACCGTCTCCCAATTGAAAGGGTCGCCACCGGGCTATGTCGGTTACGGACAGGGCGGCGTATTGAC
CGAAGCGGTGCGCAAACGGCCTTACAGCGTGGTGCTGCTGGATGAAGTCGAGAAGGCCCATCGTGATGTG
CTGAACCTGTTCTATCAGGTGTTTGACCGCGGTTTTATGCGCGACGGTGAAGGGCGCGAAATTGATTTCC
GCAACACGGTGATGGTGATGACCGCCAATCTGGGCAGTGATCATCTGATGCAGTTGCTCGATGAGCAACC
GGACGCGCCGGACAGCACCCTGCATGAACTGCTGCGGCCAATATTGCGCGACCACTTCCAGCCCGCGCTG
CTGGCCCGCTTCCAGACGCTGATCTACCGCCCACTGAATGCCCCCGCGCTGCGCACCATCGTCGAAATGA
AACTGGCACAGGTCGCTAACCGCCTCAAAAAACATTACGGCCTGCACTGCACTCTTGAAGCAAGCCTGTA
CGACACACTGGTCGCCGCCTGCCTGCTGCCGGACACCGGCGCACGCAACATCGACAGCCTGCTCAATCAG
CAGATTTTACCGGTATTGAGCCAGCAGCTGTTAAGCCGCATGAGCGAGCAACAGCGCACCACCTCGCTGA
CGCTGGGCTGGGATGAAGCCGACGGCATTACCCTTGAATTTGAAGGAGGCGAAAAATGA