SecReT6
Protein ID: 51597553
SecReT6 ID65
T6SS typei2
Gene symbol-
Locus tagYPTB3249
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]3828366..3829052 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ666K5
KEGG IDyps:YPTB3249
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.60E-47, Aligned region: 17..216
Protein Sequence: 228 a.a.     [Download]
>gi|51597553|ref|YP_071744.1| hypothetical protein YPTB3249 [Yersinia pseudotuberculosis IP 32953]
MNPHLTEHPPVGDIDVLLQDTWLQVISLRQGVTCAEGEGQAFWQRCVADIERVHQALKDAGHSEQSCQHI
RYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHFFNTLDAGSQLYERMRAVLREPAPDRAVLTCFHRVLM
LGFLGGYASPAASEREQLIDQLSVQVPAFSVAPSGGILASAASRNRLGIWLRYWPVRLGLAALMVALLWW
GLDHWLSGLLTTLLPEPV
 
Nucleotide Sequence: 687 bp     [Download]
>gi|51594359|ref|NC_006155.1|:c3829052-3828366 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGAATCCTCACCTAACCGAACACCCCCCAGTCGGGGATATTGACGTCCTGTTGCAGGACACCTGGCTAC
AGGTGATCAGCCTGCGTCAAGGGGTAACCTGTGCCGAGGGCGAAGGGCAGGCATTCTGGCAGCGCTGTGT
GGCGGACATTGAACGTGTCCATCAGGCGCTGAAAGACGCCGGTCACAGCGAGCAGAGTTGCCAGCACATC
CGATACGCCCAATGTGCACTGCTGGATGAAACTGTGAAAGGGCGCGGTGTACAGGATGATGCCTACTTCG
TGTGGTGCCATTCGCCCTTACAGGCGCATTTTTTCAATACCCTGGATGCCGGTAGCCAGCTTTACGAGCG
GATGCGCGCCGTGTTGCGTGAGCCTGCGCCGGATCGCGCGGTACTGACCTGTTTTCACCGGGTATTAATG
TTGGGCTTCCTCGGCGGGTACGCCTCCCCGGCGGCTTCTGAACGGGAGCAACTGATCGATCAACTGAGCG
TGCAGGTACCGGCGTTCAGTGTCGCGCCATCCGGTGGGATCCTGGCAAGCGCCGCCTCCCGCAACCGGTT
GGGGATCTGGCTGCGTTACTGGCCGGTACGGCTCGGGCTGGCTGCGCTGATGGTCGCGCTGTTGTGGTGG
GGCCTTGATCACTGGCTGTCCGGTCTGTTAACCACCTTACTGCCGGAGCCGGTGTAA