SecReT6
Protein ID: 51597904
SecReT6 ID66
T6SS typei1
Gene symbol-
Locus tagYPTB3613
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]4297082..4297327 [-]
ProductRhs accessory genetic element
NoteTssI
UniProt IDQ665A5
KEGG IDyps:YPTB3613
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.20E-05, Aligned region: 2..64
Protein Sequence: 81 a.a.     [Download]
>gi|51597904|ref|YP_072095.1| Rhs accessory genetic element [Yersinia pseudotuberculosis IP 32953]
MRPAMVQLKDYTFKNPNWAVAFSEQSGELQNQRPDYEHFDFPGRFKDVQHGQDFTRYRLDALRKIIAEDQ
AWRYHFQRLPS
 
Nucleotide Sequence: 246 bp     [Download]
>gi|51594359|ref|NC_006155.1|:c4297327-4297082 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
GTGCGCCCGGCGATGGTGCAACTGAAAGACTACACCTTTAAAAACCCGAACTGGGCCGTGGCCTTCAGCG
AACAGTCGGGAGAACTGCAAAACCAGCGACCGGACTACGAGCATTTTGATTTTCCGGGGCGCTTCAAAGA
TGTCCAGCACGGGCAGGATTTTACCCGCTACCGGCTGGACGCGCTGCGCAAGATCATCGCGGAAGATCAG
GCGTGGCGTTACCACTTCCAGCGGTTACCCAGTTAA