SecReT6
Protein ID: 51597908
SecReT6 ID66
T6SS typei1
Gene symbol-
Locus tagYPTB3617
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]4302826..4305024 [-]
ProductRhs accessory genetic element
NoteTssI
UniProt IDQ665A1
KEGG IDyps:YPTB3617
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.00E-70, Aligned region: 134..431
Phage_base_V [PF04717], Evalue: 1.60E-23, Aligned region: 471..563
Gp5_C [PF06715], Evalue: 1.40E-05, Aligned region: 605..628
Gp5_C [PF06715], Evalue: 1.40E-05, Aligned region: 630..654
Protein Sequence: 732 a.a.     [Download]
>gi|51597908|ref|YP_072099.1| Rhs accessory genetic element [Yersinia pseudotuberculosis IP 32953]
MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALDA
KAKVLDGGVTPLNLAAGGAGAGLPDSAAAALTRLVKQPSGLQFTLTAAGLPPQTFAVVDFTLSEMLSTPF
VLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLR
RNARIFQQASVEEIITTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAG
KNTVVYADDVGSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGE
LQNQRPDYEHFDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRSDLNHAW
QLLGIQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEY
GRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNI
PPGSLPASKTQMAFRSKTHKGEGYNEMRFEDAKGGEGLFMHAQKDMSTTVKDNQTTTVEKGNQTVTVEKG
DRTVTVATGNETTDITQGSLTETIKVRRSTCANFIQVKAEGDAPGTQLYTATEQIKFVVGKSSITLNPDS
IILQFSGSTSITLNAANIDAIAPLINLNKDKG
 
Nucleotide Sequence: 2199 bp     [Download]
>gi|51594359|ref|NC_006155.1|:c4305024-4302826 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGTTTGCTCATGATAAAGCTAATAATAATAAAGCCGCGGACAAGACCGGCACGGTGACGCCGACCCATA
TCGTCTCGCCGGAGGCCGCCCCAACCGTGAGTGGCGCTCAGATGACCGAGATGGCCGGGGGGATTGGGGA
TGCGGTGGGCGGCACTGCCGGTAAGCGCATCAATCAGGCCGCCGAGGTGGCTAAAACCGCCCTGGATGCC
AAGGCAAAAGTCCTGGACGGCGGCGTCACGCCGCTGAATCTGGCCGCGGGCGGGGCCGGGGCGGGATTGC
CGGACAGCGCGGCGGCGGCGCTTACCCGCCTGGTCAAACAGCCCTCAGGCCTGCAATTTACCCTGACGGC
GGCCGGTTTACCGCCCCAGACCTTTGCGGTGGTGGATTTCACCCTGAGCGAGATGCTCTCCACGCCGTTT
GTGCTCAATGTCGGGCTGGCGAGTGCCGATCCGGCGGTAGATTTTGCGGCGGTATTGGATGAAGACGCCA
CGCTGTTTATCTGGCGCGAAGGGGTACTGCAACGCAGCATCACCGGCATGGTCGCCAGCTTTGAACAGGG
CGATACCGGTTTTCATCAGACCCGCTACAGCATGGTGATCCGCCCGGCGCTATGGCGCACCAGCCTGCGG
CGCAATGCCCGCATCTTCCAGCAGGCCTCGGTGGAAGAGATCATCACCACCCTGCTGAAAGAGAACGGCA
TCAACGATTTTGCTTTTGGTTTTCGCCACCCGCACCCGGTGCGCGAGTTCTGCGTGCAATATCAGGAGTC
CGATTTTGATTTTATCCAGCGCCTGACGGCAGAAGAGGGGATTTTCTACTACTTCGAGTTCAGCGCCGGG
AAAAATACCGTGGTGTATGCCGATGATGTTGGCTCCCTGCCGAAAGGCGCGTCACTGCCCTATAACCCGA
ATGTGGCGGCGCAGGCGCAGGAACTGAGTATCACCACCTTCACCCGCAGTGCGCAGGTGCGCCCGGCGAT
GGTGCAACTGAAAGACTACACCTTTAAAAACCCGAACTGGGCCGCGGCCTTCAGCGAACAGTCGGGAGAA
CTGCAAAACCAGCGACCGGACTACGAGCATTTTGATTTTCCGGGGCGCTTCAAAGATGCCCAGCACGGGC
AGGATTTTACCCGCTACCGGCTGGACGCACTGCGCAATGACGCCAATCTGGGGCAGGGGGCGAGCAATGA
TTTTACCCTCCAGCCGGGGCAGTTGTTCAGCCTGTACAACCACCCACGTAGTGACCTGAACCACGCCTGG
CAGTTGCTCGGTATTCAGCACAGCGGCAAACAGATGCAGGCGCTGGAGCAGGCATCTGGCGATCAGGGCA
CGGTGCTGTTCAACCACTTCAGTTTTATTCCGCACACCCAGACCTGGCGGCCGACGCCGTTGGCTAAACC
GGCGATGGACGGCCCGCAGATCGCCATGGTGGTGGGGCCGCCGGGGGAAGAGATTTACTGCGACGAATAC
GGGCGCATCCGCCTGCAATTTTTATGGGATCGCTACGGGCAGAGCAATGACAACAGCTCCTGCTGGATCC
GGGTAACCCAGCCGTGGGCGGGCCAGGGCTGGGGCATGCTGGCCATCCCGCGTATTGGTCAGGAAGTGGT
GGTGGATTTTCTGCACGGCGATCCGGATCAACCGATTGTCACGGGGCGGACCTATCACGCCAACAACATC
CCGCCGGGGTCGTTACCGGCCAGTAAAACCCAGATGGCGTTCCGCTCAAAAACCCACAAAGGGGAAGGCT
ACAACGAAATGCGCTTCGAAGACGCCAAAGGCGGCGAAGGGCTGTTTATGCATGCTCAAAAGGATATGAG
TACCACGGTAAAAGATAACCAGACGACGACGGTGGAGAAAGGTAATCAAACCGTCACCGTGGAAAAAGGT
GACAGGACAGTCACGGTCGCGACCGGAAATGAAACCACAGATATTACCCAAGGGAGCCTGACCGAGACGA
TCAAAGTGCGTCGCAGTACCTGCGCGAATTTTATTCAGGTGAAGGCTGAAGGTGATGCGCCTGGTACGCA
ACTTTATACCGCGACGGAACAGATAAAGTTCGTGGTGGGCAAGAGCAGCATTACCTTAAATCCGGACTCT
ATTATTCTGCAATTTTCTGGCTCTACCTCTATTACGCTGAATGCCGCCAATATTGACGCCATCGCGCCAT
TGATTAACTTAAATAAAGACAAGGGATAA