SecReT6
Protein ID: 51597914
SecReT6 ID66
T6SS typei1
Gene symbol-
Locus tagYPTB3623
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]4311861..4314080 [-]
ProductRhs accessory genetic element
NoteTssI
UniProt IDQ664Z5
KEGG IDyps:YPTB3623
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.70E-70, Aligned region: 133..430
Phage_GPD [PF05954], Evalue: 8.70E-70, Aligned region: 609..644
Phage_base_V [PF04717], Evalue: 1.90E-23, Aligned region: 470..562
Protein Sequence: 739 a.a.     [Download]
>gi|51597914|ref|YP_072105.1| Rhs accessory genetic element [Yersinia pseudotuberculosis IP 32953]
MFAHDKANNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALDAK
AKVLDGGVTPLNLAAGGAGAGLPDSAAAALTRLVKQPSGLQFTLTAAGLPPQTFAVVDFTLSEMLSTPFV
LNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLRR
NARIFQQASVEEIITTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGK
NTVVYADDVGSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGEL
QNQRPDYEHFDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRSDLNHAWQ
LLGIQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEYG
RIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNIP
PGSLPASKTQMAFRSKTHKGEGYNEMRFEDAKGGEGLFMHAQKDMTTMVLNDRKTDVTQDHSEHIGQDQS
VTVVRNQSNTIQNDRRVEVTRDQQTEVGNDYQLVVKGEKKEFVTKIRYTEVHEDETLTVTKSIKMHAKQG
DISISTPNAGITITHDGAIVLQGKYIRLAADMIDLNPEE
 
Nucleotide Sequence: 2220 bp     [Download]
>gi|51594359|ref|NC_006155.1|:c4314080-4311861 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGTTTGCTCATGATAAAGCTAATAATAAAGCCGCGGACAAGACCGGCACGGTGACGCCGACCCATATCG
TCTCGCCGGAGGCCGCCCCAACCGTGAGTGGCGCTCAGATGACCGAGATGGCCGGGGGGATTGGGGATGC
GGTGGGCGGCACTGCCGGTAAGCGCATCAATCAGGCCGCCGAGGTGGCTAAAACCGCCCTGGATGCCAAG
GCAAAAGTCCTGGACGGCGGCGTCACGCCGCTGAATCTGGCCGCGGGCGGGGCCGGGGCGGGATTGCCGG
ACAGCGCGGCGGCGGCGCTTACCCGCCTGGTCAAACAGCCCTCAGGCCTGCAATTTACCCTGACGGCGGC
CGGTTTACCGCCCCAGACCTTTGCGGTGGTGGATTTCACCCTGAGCGAGATGCTCTCCACGCCGTTTGTG
CTCAATGTCGGGCTGGCGAGTGCCGATCCGGCGGTAGATTTTGCGGCGGTATTGGATGAAGACGCCACGC
TGTTTATCTGGCGCGAAGGGGTACTGCAACGCAGCATCACCGGCATGGTCGCCAGCTTTGAACAGGGCGA
TACCGGTTTTCATCAGACCCGCTACAGCATGGTGATCCGCCCGGCGCTATGGCGCACCAGCCTGCGGCGC
AATGCCCGCATCTTCCAGCAGGCCTCGGTGGAAGAGATCATCACCACCCTGCTGAAAGAGAACGGCATCA
ACGATTTTGCTTTTGGTTTTCGCCACCCGCACCCGGTGCGCGAGTTCTGCGTGCAATATCAGGAGTCCGA
TTTTGATTTTATCCAGCGCCTGACGGCAGAAGAGGGGATTTTCTACTACTTCGAGTTCAGCGCCGGGAAA
AATACCGTGGTGTATGCCGATGATGTTGGCTCCCTGCCGAAAGGCGCGTCACTGCCCTATAACCCGAATG
TGGCGGCGCAGGCGCAGGAACTGAGTATCACCACCTTCACCCGCAGTGCGCAGGTGCGCCCGGCGATGGT
GCAACTGAAAGACTACACCTTTAAAAACCCGAACTGGGCCGCGGCCTTCAGCGAACAGTCGGGAGAACTG
CAAAACCAGCGACCGGACTACGAGCATTTTGATTTTCCGGGGCGCTTCAAAGATGCCCAGCACGGGCAGG
ATTTTACCCGCTACCGGCTGGACGCACTGCGCAATGACGCCAATCTGGGGCAGGGGGCGAGCAATGATTT
TACCCTCCAGCCGGGGCAGTTGTTCAGCCTGTACAACCACCCACGTAGTGACCTGAACCACGCCTGGCAG
TTGCTCGGTATTCAGCACAGCGGCAAACAGATGCAGGCGCTGGAGCAGGCATCTGGCGATCAGGGCACGG
TGCTGTTCAACCACTTCAGTTTTATTCCGCACACCCAGACCTGGCGGCCGACGCCGTTGGCTAAACCGGC
GATGGACGGCCCGCAGATCGCCATGGTGGTGGGGCCGCCGGGGGAAGAGATTTACTGCGACGAATACGGG
CGCATCCGCCTGCAATTTTTATGGGATCGCTACGGGCAGAGCAATGACAACAGCTCCTGCTGGATCCGGG
TAACCCAGCCGTGGGCGGGCCAGGGCTGGGGCATGCTGGCCATCCCGCGTATTGGTCAGGAAGTGGTGGT
GGATTTTCTGCACGGCGATCCGGATCAACCGATTGTCACGGGGCGGACCTATCACGCCAACAACATCCCG
CCGGGGTCGTTACCGGCCAGTAAAACCCAGATGGCGTTCCGCTCAAAAACCCACAAAGGGGAAGGCTACA
ACGAAATGCGCTTCGAAGACGCCAAAGGCGGCGAAGGGCTGTTTATGCATGCGCAGAAAGATATGACGAC
CATGGTGCTGAATGATCGCAAAACCGATGTGACTCAGGACCATTCAGAGCACATTGGGCAAGACCAGTCC
GTGACGGTTGTGCGTAACCAAAGTAATACGATCCAAAATGATCGCCGGGTAGAGGTGACTCGCGATCAAC
AAACCGAAGTGGGCAATGATTACCAGCTAGTGGTGAAAGGTGAAAAGAAAGAGTTTGTGACGAAAATTCG
TTACACCGAAGTGCATGAAGACGAAACGCTCACGGTGACGAAAAGCATTAAAATGCATGCCAAACAAGGT
GATATCAGCATATCAACCCCGAATGCCGGAATTACGATCACCCATGACGGTGCCATTGTTCTGCAAGGGA
AATACATTCGTTTAGCGGCCGATATGATCGATCTTAATCCAGAGGAGTAG