SecReT6
Protein ID: 51597915
SecReT6 ID66
T6SS typei1
Gene symbol-
Locus tagYPTB3624
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]4314102..4315415 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ664Z4
KEGG IDyps:YPTB3624
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.20E-48, Aligned region: 90..154
DUF3702 [PF12486], Evalue: 1.20E-48, Aligned region: 284..431
ImpA-rel_N [PF06812], Evalue: 5.80E-22, Aligned region: 41..101
Protein Sequence: 437 a.a.     [Download]
>gi|51597915|ref|YP_072106.1| hypothetical protein YPTB3624 [Yersinia pseudotuberculosis IP 32953]
MSDTPQHIIIKTGTDPRNRPEFNAIREEINKINHPARPEVNWGLIESLALTLFRTHGVDLQTAVYYTLAR
TQKNGLAGFTEGCELLAGMVVGQWDHLWPEQPQARSEILEWFNTRVSNQLRQHDFTRDDLRLVYRAERAL
QLLYDKLQQVELKRVPRIENLLYLMQNTAKKLESASDAAKAQQTAAPLKMPPMVYLSVPEAEPVRTAAAA
PEPAANIEVRSPPPETKRGAVLWGFGAGVLCSLLVATAVYVTQFKPLQQQMTVLATQPESAALLWLNRPD
VATYGEQLSTLENLSPLFVLNTADQSVAMARQRWPSDPSQVAESQRWARLVEARIGLAGTDSSYFQLQQR
LHALSEKLLEQERSRGSLTISYLKTAVYQMQTELNREIPLEELLRQLAVSADEHQPASPVLIKQIDDRWN
ALLSRYHHLTQQTNSAR
 
Nucleotide Sequence: 1314 bp     [Download]
>gi|51594359|ref|NC_006155.1|:c4315415-4314102 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGAGTGACACCCCGCAACATATCATCATTAAAACCGGCACTGACCCACGGAACCGGCCGGAATTTAACG
CCATCCGTGAAGAGATCAACAAAATCAACCACCCGGCACGGCCAGAGGTCAACTGGGGTTTGATTGAATC
ACTGGCGCTGACCCTGTTCCGTACCCACGGCGTGGATTTGCAGACGGCGGTGTATTACACGCTGGCCCGC
ACCCAAAAAAATGGCCTGGCCGGTTTCACCGAGGGCTGCGAGTTGCTGGCCGGTATGGTGGTCGGCCAGT
GGGATCACCTGTGGCCAGAACAGCCGCAGGCACGCAGTGAAATACTGGAATGGTTCAATACCCGCGTCAG
CAATCAACTGCGTCAGCATGATTTTACCCGTGACGATCTGCGGCTGGTGTACCGCGCTGAGCGGGCCTTG
CAGTTGCTGTACGATAAATTGCAACAGGTTGAATTAAAACGGGTACCGCGCATTGAAAACCTGCTGTACC
TGATGCAGAACACCGCCAAAAAACTCGAATCGGCCAGTGACGCGGCGAAGGCTCAGCAAACTGCGGCCCC
GCTGAAAATGCCGCCTATGGTCTATCTCTCGGTACCCGAGGCCGAGCCTGTCCGGACGGCAGCGGCAGCC
CCTGAGCCTGCGGCCAATATTGAGGTGCGTTCGCCCCCCCCGGAGACCAAACGGGGGGCGGTGCTGTGGG
GCTTTGGTGCCGGTGTCCTGTGCAGTTTACTGGTGGCGACTGCGGTTTACGTTACCCAGTTCAAACCGCT
GCAACAGCAAATGACGGTGCTGGCCACCCAACCGGAAAGCGCGGCATTGCTGTGGCTCAACCGCCCGGAT
GTCGCCACCTATGGTGAGCAACTGAGCACCCTGGAAAACCTCTCGCCCCTGTTTGTGCTCAATACCGCCG
ACCAGTCGGTGGCGATGGCTCGTCAACGCTGGCCGTCCGATCCCAGTCAGGTGGCCGAAAGCCAGCGCTG
GGCGCGGTTGGTGGAGGCGCGTATCGGCCTGGCCGGTACCGACAGCAGCTATTTCCAGCTCCAGCAGCGC
TTGCATGCGCTGTCTGAAAAATTACTCGAACAGGAACGTTCTCGGGGCAGTCTGACTATCTCCTATCTAA
AAACAGCAGTTTACCAGATGCAGACCGAGCTGAACCGGGAGATACCGCTGGAGGAGTTACTGCGCCAGTT
GGCGGTGTCCGCCGATGAACATCAACCGGCCTCGCCGGTCTTGATAAAACAAATTGATGACCGCTGGAAC
GCCTTACTCAGCCGTTATCACCACTTAACGCAGCAGACGAACTCTGCCCGTTAA