SecReT6
Protein ID: 51597921
SecReT6 ID66
T6SS typei1
Gene symbol-
Locus tagYPTB3630
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]4324590..4325357 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ664Y8
KEGG IDyps:YPTB3630
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.30E-63, Aligned region: 34..239
Protein Sequence: 255 a.a.     [Download]
>gi|51597921|ref|YP_072112.1| hypothetical protein YPTB3630 [Yersinia pseudotuberculosis IP 32953]
MKTDAVTDNTPFPAAEAVTSHRQYQLPLRGESLNAMIDTATPLLGMVLRLKDMENQALPDQLYQQVVTDI
RAIEQYLQTKGYEPGAIISFRYVLCTFIDETALGHGWNTQNGWLQQSLLVHFHNETWGGEKVYVLLERLM
GEPKRYQDLLEFIYLCFCLGYRGRYKVTSQNGDDFERLFRRLHHQLQQLRGDAPPTVLYQGGGRLNSRYH
LSKRLTIKHLLWGGVSLLVVIYLFYAIHLHTQSQDILQQLNNLLS
 
Nucleotide Sequence: 768 bp     [Download]
>gi|51594359|ref|NC_006155.1|:c4325357-4324590 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGAAAACAGATGCTGTGACTGACAACACCCCTTTCCCCGCAGCGGAAGCGGTCACCTCCCATCGGCAGT
ATCAGCTACCGCTACGTGGCGAAAGCTTGAACGCGATGATCGATACCGCCACCCCATTATTGGGGATGGT
ACTGCGCCTGAAAGACATGGAAAACCAAGCGTTACCGGACCAGCTATATCAGCAGGTGGTGACGGATATC
CGTGCTATTGAGCAGTACTTGCAAACCAAAGGCTACGAACCCGGCGCAATCATATCTTTCCGATATGTGC
TGTGCACATTCATCGATGAAACGGCATTAGGGCATGGCTGGAACACCCAAAACGGTTGGTTACAGCAATC
TCTGTTGGTGCATTTTCATAATGAAACCTGGGGCGGAGAGAAAGTGTACGTCCTGCTGGAACGCTTAATG
GGGGAACCCAAGCGTTACCAAGACCTGCTGGAGTTTATCTATCTCTGTTTTTGTTTGGGTTACCGCGGCC
GCTACAAAGTGACATCACAAAACGGTGATGACTTTGAGCGATTGTTCCGCCGATTGCATCATCAATTACA
GCAGTTACGGGGTGATGCGCCGCCGACGGTCCTTTATCAAGGGGGCGGCCGTCTGAATAGCCGCTACCAC
TTGAGTAAACGGTTGACTATCAAGCATTTGTTATGGGGTGGCGTGAGTCTGCTGGTGGTGATTTATCTGT
TTTATGCCATCCACCTGCACACCCAAAGTCAGGATATTTTGCAACAGCTAAACAATTTATTGAGCTAG