SecReT6
Protein ID: 51597926
SecReT6 ID66
T6SS typei1
Gene symbol-
Locus tagYPTB3635
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]4329745..4331565 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ664Y3
KEGG IDyps:YPTB3635
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.50E-200, Aligned region: 3..606
Protein Sequence: 606 a.a.     [Download]
>gi|51597926|ref|YP_072117.1| hypothetical protein YPTB3635 [Yersinia pseudotuberculosis IP 32953]
MSFEKYFRDELDYLRQLGRDAAIERPHLAAFLSEQGSDPDVERLLEGFAFLTGNLREKIDDQFPELTHGL
LNMLWPNYLRPIPSMTIIEYTPDESVVTEATLVKRGSQVMSIPIAQNGQRSAFINSNAHAGPQCTFTLCR
DVWLFPMSIREISANSSNEQGILSVHFAAKAELNLQDLQLDKLRFYLGEDNYTSTQLYFWINHYFERAEL
VVNGITIPMPDFDFNPVGFERDDALLPYPKNAYMGYRILQEYFCFPEGFLFFDVNGVVDFPPHLNASEFS
LNLYFSQALPPDVKVRSTTLRMNCTPAVNLFQHDSEAIDLDGTQTEYPLCVSYHNPDHYDIFSVDRVDSW
LSEKGAPKGRGRGHGRVYTSFESFHHQIEHSQEKTALYYRLRVKNSLFRKGFEHYISFVRSDESKLVLAE
ENVSVSLTCTNRELPLSLRVGDINQLSTDSPSFATFRNITRPSVPLYPVLDGGLHWSLLSNMSLNYMSLL
DKDALKQILHTYDFPSLHNRQSARASQKKLDAIQRIETQPIDRLFRGLPVRGLQTTLWLEQGAFSSEGEL
YLFSTVLARFFSLYASVNAFHLLKVINLDNQECYEWPVQTGQHALM
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|51594359|ref|NC_006155.1|:c4331565-4329745 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGTCGTTCGAAAAGTATTTCAGGGACGAGCTGGACTACCTCCGGCAATTAGGACGCGATGCCGCAATAG
AACGGCCTCATCTCGCTGCATTTTTATCTGAGCAAGGTTCTGATCCGGATGTTGAACGTTTGCTGGAAGG
CTTTGCTTTTCTAACGGGCAACCTGCGTGAAAAAATCGATGATCAATTCCCTGAATTGACTCATGGTTTA
CTGAATATGTTGTGGCCGAACTACTTACGGCCAATACCGAGCATGACCATCATCGAGTACACACCGGATG
AAAGTGTGGTCACCGAGGCGACGCTGGTGAAACGGGGTAGCCAAGTGATGAGTATCCCCATCGCACAAAA
TGGTCAGCGCAGCGCGTTTATCAACAGTAATGCTCATGCCGGGCCACAATGTACTTTTACGTTGTGCCGT
GATGTGTGGTTGTTCCCCATGTCCATCCGGGAGATCTCGGCGAACAGCAGTAACGAACAAGGCATTTTGA
GTGTTCACTTTGCCGCCAAAGCGGAATTGAACTTACAAGACCTGCAATTGGATAAATTGCGCTTTTATCT
GGGCGAAGACAACTACACCAGCACGCAACTCTATTTCTGGATTAACCACTATTTCGAACGCGCTGAACTG
GTTGTCAACGGGATAACCATCCCGATGCCTGATTTTGACTTTAACCCAGTGGGCTTTGAACGCGATGATG
CCCTCTTGCCGTACCCGAAAAACGCCTATATGGGTTACCGGATCCTGCAAGAGTATTTTTGCTTCCCCGA
AGGCTTTTTGTTCTTTGATGTCAATGGTGTGGTCGATTTTCCGCCGCACTTGAATGCCAGTGAATTCTCT
CTGAATTTGTATTTCTCTCAGGCATTGCCGCCGGACGTGAAAGTCCGCTCCACCACACTGCGAATGAATT
GCACACCTGCGGTGAACCTGTTCCAACATGACAGTGAAGCGATTGATCTTGATGGAACCCAGACGGAATA
TCCGCTCTGTGTCAGCTACCATAATCCGGATCACTACGACATCTTTTCAGTTGATCGGGTTGACAGTTGG
CTCAGTGAAAAAGGTGCTCCTAAGGGGCGCGGCCGGGGTCATGGCAGGGTGTACACCTCGTTTGAGAGCT
TCCACCATCAGATCGAACACTCGCAAGAAAAGACCGCACTTTATTACCGCCTACGTGTGAAAAATTCATT
ATTCCGTAAGGGATTCGAACACTACATTTCCTTTGTTCGCAGTGATGAATCGAAGCTGGTGCTTGCTGAA
GAGAATGTCTCGGTCAGCCTGACGTGCACCAACCGTGAGTTGCCGCTGTCGTTGCGCGTTGGTGATATCA
ATCAACTCAGCACAGACAGCCCTTCATTCGCGACGTTCCGCAATATTACCCGTCCTTCCGTGCCGTTGTA
TCCGGTGCTGGATGGGGGCCTGCATTGGTCATTGCTCTCCAATATGTCGTTGAACTACATGTCCTTACTG
GATAAGGACGCGTTGAAGCAAATTCTGCATACCTATGATTTCCCAAGCCTGCATAACCGGCAATCTGCCA
GGGCATCGCAAAAGAAACTGGACGCTATCCAACGTATTGAAACACAACCGATTGACCGGTTGTTTCGTGG
CTTACCTGTCAGAGGGCTACAAACCACGCTATGGCTGGAGCAAGGGGCCTTTAGCTCTGAAGGCGAGCTT
TATCTCTTTAGCACGGTATTAGCTCGCTTCTTCTCACTGTATGCCAGCGTCAATGCGTTTCATCTTTTAA
AAGTCATCAATCTTGATAATCAGGAATGTTACGAATGGCCGGTACAGACAGGTCAACATGCACTGATGTA
A