SecReT6
Protein ID: 521459473
SecReT6 ID815
T6SS typei1
Gene symbol-
Locus tagSCE1572_30305
StrainSorangium cellulosum So0157-2
Repliconchromosome [GenBank: NC_021658] [Browse all T6SS(s) in this replicon]
Location [Strand]8611519..8613003 [-]
Producttype VI secretion protein
NoteTssC
UniProt IDS4XJB4
KEGG IDscu:SCE1572_30305
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.80E-186, Aligned region: 67..492
Protein Sequence: 494 a.a.     [Download]
>gi|521459473|ref|YP_008152449.1| type VI secretion protein [Sorangium cellulosum So0157-2]
MATETQAAGSAGVQTLEGGSLLDEILAETKMTPGDEGYEIAKRGVQAFISELVAPRREGEKVDKAFVDAL
IAEIDVKLSRQIDEILHHPSFQKLESAWRGLKFVIDRCDFRENVKVEMLNCSKEDLLADFEDAPEVPKSG
LYKLVYSAEFGQFGGKPVGAIIANYEFGPGPQDIALLQKCAAVAAMSHAPFIAAAGPQFFGLKDFIGLPN
LKDLKALFEGPQYTKWNAFRETEDSRYVGLVMPRFLLRLPFGANTVPVKAFNYEEDVVGKHDAYCWGNAT
YAFATRLADSFAKYRWCPNIIGPQAGGAVENLPLHQYEAMGEIQTKIPTEIMLTERREFELSEEGFIGLT
FRKDSDNACFFSANSAQKPKFYGQSEEGRAAEMNYRLGTQLPYMFIMCRIAHYLKVLQREQIGTWKERAD
LERELNEWIGQYVADQDVVSAATRGRRPLRKARIIVTEVPGNAGWYKVDMQVRPHFKYMGAFFTLSLVGK
LDKE
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|521458881|ref|NC_021658.1|:c8613003-8611519 Sorangium cellulosum So0157-2, complete genome
ATGGCGACGGAGACACAGGCCGCGGGGAGCGCAGGCGTCCAGACCCTGGAGGGAGGGTCGCTGCTCGACG
AGATCCTCGCCGAGACGAAGATGACGCCCGGCGACGAGGGGTACGAGATCGCCAAGCGGGGCGTGCAGGC
CTTCATCTCGGAGCTCGTCGCCCCGCGGCGCGAGGGTGAGAAGGTCGACAAGGCCTTCGTCGACGCGCTG
ATCGCGGAGATCGACGTCAAGCTCTCGCGGCAGATCGACGAGATCCTCCACCACCCCAGCTTCCAGAAGC
TCGAGTCCGCCTGGCGCGGCCTCAAGTTCGTCATCGACCGCTGCGACTTTCGCGAGAACGTCAAGGTCGA
GATGCTCAACTGCTCCAAGGAGGACCTCCTCGCCGATTTCGAGGACGCCCCCGAGGTGCCGAAGAGCGGC
CTGTACAAGCTCGTCTACTCGGCGGAGTTCGGCCAGTTCGGCGGCAAGCCGGTCGGCGCGATCATCGCGA
ACTACGAGTTCGGCCCCGGCCCCCAGGACATCGCGCTGCTCCAGAAGTGCGCCGCCGTCGCGGCGATGTC
GCACGCGCCGTTCATCGCGGCGGCGGGCCCGCAGTTCTTCGGCCTCAAGGACTTCATCGGGCTGCCCAAC
CTGAAGGACCTGAAGGCGCTCTTCGAGGGGCCGCAGTACACGAAGTGGAACGCGTTCCGCGAGACCGAGG
ACTCGCGCTACGTCGGCCTCGTGATGCCGCGCTTCCTGCTCCGCCTGCCCTTCGGCGCCAACACCGTCCC
GGTGAAGGCGTTCAACTACGAAGAGGACGTGGTCGGCAAGCACGACGCGTACTGCTGGGGCAACGCGACG
TACGCCTTCGCCACGCGGCTCGCCGACAGCTTCGCCAAGTACCGCTGGTGTCCCAACATCATCGGCCCGC
AGGCGGGCGGCGCGGTGGAGAACCTGCCGCTCCACCAGTACGAGGCGATGGGCGAGATCCAGACCAAGAT
CCCGACCGAGATCATGCTCACCGAGCGGCGCGAGTTCGAGCTGTCCGAGGAGGGCTTCATCGGGCTCACG
TTCCGCAAGGACTCGGACAACGCCTGCTTCTTCTCGGCGAACTCGGCGCAGAAGCCCAAGTTCTACGGGC
AGAGCGAGGAGGGCAGGGCGGCCGAGATGAACTACCGGCTCGGGACGCAGCTGCCGTACATGTTCATCAT
GTGCCGCATCGCGCACTACCTGAAGGTGCTGCAGCGCGAGCAGATCGGGACGTGGAAGGAGCGCGCCGAC
CTCGAGAGGGAGCTGAACGAGTGGATCGGCCAGTACGTCGCCGATCAGGACGTCGTCTCCGCGGCGACCC
GCGGGCGCCGGCCGCTCCGCAAGGCGAGGATCATCGTGACCGAGGTGCCGGGCAACGCCGGCTGGTACAA
GGTCGACATGCAGGTGCGCCCGCACTTCAAGTACATGGGCGCGTTCTTCACGCTGAGCCTCGTCGGCAAG
CTCGACAAGGAGTGA