SecReT6
Protein ID: 521459474
SecReT6 ID815
T6SS typei1
Gene symbol-
Locus tagSCE1572_30310
StrainSorangium cellulosum So0157-2
Repliconchromosome [GenBank: NC_021658] [Browse all T6SS(s) in this replicon]
Location [Strand]8613007..8613498 [-]
Producthypothetical protein
NoteTssB
UniProt IDS4XLG1
KEGG IDscu:SCE1572_30310
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.50E-56, Aligned region: 4..157
Protein Sequence: 163 a.a.     [Download]
>gi|521459474|ref|YP_008152450.1| hypothetical protein SCE1572_30310 [Sorangium cellulosum So0157-2]
MKEGSVAPKERVNITYKPATGNAKEDVELPLKMLMLGDYTQRPDPRPLEDRKPINVDKDNFQKVMSEQKL
ALTFNVKDVLSEQENSELTVNLKFRRLSDMEPEAIATQVPELKKLLDLRAALTALKGPLGNEKAFRNKIQ
QILSDPAQRNKIVSELGLDKEGE
 
Nucleotide Sequence: 492 bp     [Download]
>gi|521458881|ref|NC_021658.1|:c8613498-8613007 Sorangium cellulosum So0157-2, complete genome
ATGAAAGAGGGATCGGTCGCGCCGAAGGAGCGCGTGAACATCACGTACAAGCCGGCCACGGGGAACGCGA
AGGAGGACGTCGAGCTGCCGCTGAAGATGCTGATGCTCGGCGACTACACGCAGCGGCCGGATCCGCGGCC
CCTCGAGGACCGCAAGCCGATCAACGTGGACAAGGACAACTTCCAGAAGGTCATGAGCGAGCAGAAGCTC
GCGCTCACCTTCAACGTCAAGGACGTCCTGTCCGAGCAGGAGAACAGCGAGCTCACGGTCAACCTCAAGT
TCCGCCGGCTGAGCGACATGGAGCCCGAGGCCATCGCGACCCAGGTGCCGGAGCTCAAGAAGCTCCTCGA
CCTGCGCGCCGCGCTGACGGCCCTCAAGGGCCCGCTCGGGAACGAGAAGGCGTTCCGCAACAAGATTCAG
CAGATCCTGAGCGACCCGGCTCAGCGCAACAAGATCGTGAGCGAGCTCGGGCTCGACAAGGAAGGGGAGT
GA