SecReT6
Protein ID: 521459475
SecReT6 ID815
T6SS typei1
Gene symbol-
Locus tagSCE1572_30350
StrainSorangium cellulosum So0157-2
Repliconchromosome [GenBank: NC_021658] [Browse all T6SS(s) in this replicon]
Location [Strand]8623627..8626326 [-]
ProductATPase AAA
NoteTssH
UniProt IDS4XJC1
KEGG IDscu:SCE1572_30350
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.60E-41, Aligned region: 231..253
AAA_2 [PF07724], Evalue: 1.60E-41, Aligned region: 466..537
AAA_2 [PF07724], Evalue: 1.60E-41, Aligned region: 620..795
AAA [PF00004], Evalue: 4.80E-17, Aligned region: 233..350
AAA [PF00004], Evalue: 4.80E-17, Aligned region: 519..550
AAA [PF00004], Evalue: 4.80E-17, Aligned region: 625..750
AAA_16 [PF13191], Evalue: 2.30E-13, Aligned region: 48..81
AAA_16 [PF13191], Evalue: 2.30E-13, Aligned region: 210..249
AAA_16 [PF13191], Evalue: 2.30E-13, Aligned region: 283..316
AAA_16 [PF13191], Evalue: 2.30E-13, Aligned region: 487..542
AAA_16 [PF13191], Evalue: 2.30E-13, Aligned region: 609..635
AAA_16 [PF13191], Evalue: 2.30E-13, Aligned region: 688..718
AAA_16 [PF13191], Evalue: 2.30E-13, Aligned region: 791..837
ClpB_D2-small [PF10431], Evalue: 8.70E-13, Aligned region: 473..494
ClpB_D2-small [PF10431], Evalue: 8.70E-13, Aligned region: 804..875
AAA_5 [PF07728], Evalue: 3.30E-12, Aligned region: 233..253
AAA_5 [PF07728], Evalue: 3.30E-12, Aligned region: 493..530
AAA_5 [PF07728], Evalue: 3.30E-12, Aligned region: 624..744
AAA_25 [PF13481], Evalue: 1.20E-07, Aligned region: 233..268
AAA_25 [PF13481], Evalue: 1.20E-07, Aligned region: 294..330
AAA_25 [PF13481], Evalue: 1.20E-07, Aligned region: 441..545
AAA_25 [PF13481], Evalue: 1.20E-07, Aligned region: 604..650
AAA_22 [PF13401], Evalue: 8.50E-07, Aligned region: 232..324
AAA_22 [PF13401], Evalue: 8.50E-07, Aligned region: 470..499
AAA_22 [PF13401], Evalue: 8.50E-07, Aligned region: 621..638
AAA_22 [PF13401], Evalue: 8.50E-07, Aligned region: 685..718
Arch_ATPase [PF01637], Evalue: 2.90E-06, Aligned region: 211..247
Arch_ATPase [PF01637], Evalue: 2.90E-06, Aligned region: 291..386
Arch_ATPase [PF01637], Evalue: 2.90E-06, Aligned region: 500..545
Arch_ATPase [PF01637], Evalue: 2.90E-06, Aligned region: 620..636
Arch_ATPase [PF01637], Evalue: 2.90E-06, Aligned region: 695..706
Clp_N [PF02861], Evalue: 2.00E-05, Aligned region: 34..78
Clp_N [PF02861], Evalue: 2.00E-05, Aligned region: 325..335
Clp_N [PF02861], Evalue: 2.00E-05, Aligned region: 486..498
NACHT [PF05729], Evalue: 4.90E-05, Aligned region: 233..260
NACHT [PF05729], Evalue: 4.90E-05, Aligned region: 434..469
NACHT [PF05729], Evalue: 4.90E-05, Aligned region: 624..649
IstB_IS21 [PF01695], Evalue: 5.60E-05, Aligned region: 216..253
IstB_IS21 [PF01695], Evalue: 5.60E-05, Aligned region: 624..642
IstB_IS21 [PF01695], Evalue: 5.60E-05, Aligned region: 734..749
Sigma54_activat [PF00158], Evalue: 0.00011, Aligned region: 215..247
Sigma54_activat [PF00158], Evalue: 0.00011, Aligned region: 603..740
AAA_29 [PF13555], Evalue: 0.00011, Aligned region: 227..255
AAA_29 [PF13555], Evalue: 0.00011, Aligned region: 620..637
AAA_18 [PF13238], Evalue: 0.00034, Aligned region: 233..252
AAA_18 [PF13238], Evalue: 0.00034, Aligned region: 435..492
AAA_18 [PF13238], Evalue: 0.00034, Aligned region: 625..648
DUF258 [PF03193], Evalue: 0.0014, Aligned region: 222..249
DUF258 [PF03193], Evalue: 0.0014, Aligned region: 609..635
AAA_19 [PF13245], Evalue: 0.0028, Aligned region: 171..177
AAA_19 [PF13245], Evalue: 0.0028, Aligned region: 230..253
AAA_19 [PF13245], Evalue: 0.0028, Aligned region: 618..642
Protein Sequence: 899 a.a.     [Download]
>gi|521459475|ref|YP_008152458.1| ATPase AAA [Sorangium cellulosum So0157-2]
MPRMQLVDTKAIVKRLTKNCTSALEAAIGQCVNARHYEVTLEHLLLALLDDANSDIAFLVSHYDLDPSHL
RAALQRSLEELRKGNAGRPVLSPTMLEWMQDAYLVGSMEYGYQRVRSGVLFQRLVQQPTRYSVSGIGAYL
EGISKDDLKTNLSKIVSGSKEEAEAAAASAGAPGAGKLPAGMASAGPDSALAKFCVDYTGKARAGQIDPI
FGREREIRQVIDILARRRKNNPIIVGDAGVGKTALVEGLALLIVESSPENPKVPPLLQGVDILGLDMGLL
QAGAGVKGEFENRMKQVIAEVKGSSKPIILFIDEAHTLIGAGGQQGGGDAANLLKPALARGELRTIAATT
WSEYKKYFEKDAALERRFQPVKVDEPSEPAAVVMLRGLRPKFEQAHNVIIQDEAVTAAVRLSARYLTGRQ
LPDKAVDLLDTCAARVKVALQQRPAAVEDAEILIVNTETELKALERDRDKGVHIDAERVAELKERLAKAK
AELEEVRAAYAKETAGTQKVIDARKKMDEAKSNEERDAARREVVKALDELKQSQGEVPLIRPDVDEAMVA
SVVAAWTGIPVGKMVQDDVKALLEMEDRLTRRIKGQTHGIVTISKELRSARAGLKPLSTPQGVFLLVGPS
GVGKTETALGIADLMFGGERMMTVINMSEFQEKHTVSRLIGSPPGYVGYGEGGMLTEAVRQRPYTVVLLD
EVEKADPDVLNLFYQVFDKGMLSDGEGRLVDFKNTVIILTSNLATDKITNMTIAAREEDPARRLDADGEF
IKEVVEAIKPTLSAHFKPALLARMTTVPYLPISPDALGEITRLKLDALVDRLRKSQRIEASYSDALVDTI
AARCTEVDTGARNIDHILRASLLPQLSVAVLEKMAEGPLPKRLQIGVDAEKNFTVSFSD
 
Nucleotide Sequence: 2700 bp     [Download]
>gi|521458881|ref|NC_021658.1|:c8626326-8623627 Sorangium cellulosum So0157-2, complete genome
ATGCCTCGCATGCAGCTCGTCGACACCAAGGCCATCGTCAAGCGACTCACCAAGAACTGCACTTCAGCCC
TCGAGGCGGCGATTGGCCAGTGTGTCAACGCGCGCCACTACGAGGTCACGCTCGAGCACCTGCTCCTCGC
GCTGCTCGACGACGCGAACTCCGACATCGCGTTTCTCGTATCCCACTATGATCTCGACCCGTCGCACCTC
CGCGCCGCGCTCCAGCGCAGCCTGGAGGAGCTGAGGAAGGGGAACGCCGGGAGGCCGGTGCTCTCTCCGA
CGATGCTCGAGTGGATGCAGGACGCCTATCTCGTCGGATCCATGGAGTATGGCTACCAGCGGGTGCGGAG
CGGCGTGCTCTTCCAGCGCCTCGTCCAGCAGCCGACCCGGTACTCGGTGAGCGGCATCGGCGCTTACCTC
GAGGGCATCTCGAAAGACGATCTCAAGACCAACCTCTCCAAGATCGTCTCCGGCTCGAAGGAAGAGGCCG
AGGCCGCCGCGGCGTCCGCGGGCGCGCCCGGGGCGGGGAAGCTGCCGGCCGGCATGGCGAGCGCCGGGCC
CGACTCGGCCCTGGCGAAGTTCTGCGTCGACTACACAGGCAAGGCGCGCGCGGGGCAGATCGATCCGATC
TTCGGCCGCGAGCGGGAGATCCGGCAGGTCATCGACATCCTCGCGCGGCGCCGCAAGAACAACCCGATCA
TCGTCGGCGACGCGGGCGTCGGCAAGACGGCGCTCGTCGAGGGGCTCGCGCTGCTCATCGTCGAGAGCTC
GCCGGAGAACCCGAAGGTGCCGCCGCTCCTGCAAGGGGTCGACATCCTCGGGCTCGACATGGGCCTGCTC
CAGGCGGGCGCCGGCGTGAAGGGCGAGTTCGAGAACCGCATGAAGCAGGTGATCGCCGAGGTGAAGGGGT
CGTCGAAGCCGATCATCCTCTTCATCGACGAGGCGCACACGCTCATCGGCGCGGGCGGCCAGCAGGGCGG
CGGCGACGCGGCCAACCTGCTCAAGCCGGCGCTCGCCCGCGGCGAGCTCCGGACGATCGCGGCCACGACG
TGGAGCGAGTACAAGAAGTACTTCGAGAAGGACGCGGCGCTGGAGCGGCGCTTCCAGCCCGTCAAGGTCG
ACGAGCCGAGCGAGCCGGCCGCCGTCGTGATGCTCCGCGGGCTCCGGCCGAAGTTCGAGCAGGCCCACAA
CGTCATCATCCAGGACGAGGCGGTGACCGCCGCCGTGCGGCTCTCGGCGCGCTACCTGACCGGCAGGCAG
CTGCCGGACAAGGCGGTCGACCTGCTCGACACGTGCGCGGCGCGGGTGAAGGTCGCGCTGCAGCAGCGCC
CCGCCGCGGTCGAGGACGCCGAGATCCTCATCGTGAACACCGAGACCGAGCTCAAGGCGCTCGAGCGCGA
TCGGGACAAGGGCGTGCACATCGACGCCGAGCGGGTCGCCGAGCTCAAGGAGCGGCTCGCCAAGGCGAAG
GCCGAGCTCGAGGAGGTGCGCGCCGCCTACGCGAAGGAGACGGCCGGCACGCAGAAGGTCATCGACGCCC
GCAAGAAGATGGACGAGGCGAAGTCGAACGAGGAGCGCGACGCCGCCCGCCGCGAGGTGGTGAAGGCCCT
CGACGAGCTCAAGCAGAGCCAGGGCGAGGTGCCGCTGATCCGGCCGGACGTCGACGAGGCCATGGTGGCG
AGCGTCGTGGCGGCGTGGACGGGCATCCCCGTCGGCAAGATGGTCCAGGACGACGTGAAGGCGCTCCTCG
AGATGGAGGACCGGCTGACCCGGCGGATCAAGGGGCAGACGCACGGCATCGTGACCATCTCGAAGGAGCT
CCGGAGCGCGCGCGCGGGGCTGAAGCCGCTGAGCACGCCGCAGGGCGTGTTCCTGCTCGTCGGGCCGAGC
GGCGTCGGCAAGACGGAGACCGCGCTCGGGATCGCCGACCTCATGTTCGGCGGCGAGCGGATGATGACCG
TCATCAACATGTCCGAGTTCCAGGAGAAGCACACGGTCTCCCGGCTCATCGGCTCGCCGCCCGGCTACGT
CGGCTACGGCGAGGGCGGCATGCTCACCGAGGCCGTGCGCCAGCGGCCCTACACGGTCGTGCTCCTCGAC
GAGGTCGAGAAGGCCGATCCCGACGTGCTGAACCTGTTCTACCAGGTGTTCGACAAGGGCATGCTGAGCG
ACGGCGAGGGGCGGCTCGTCGACTTCAAGAACACGGTCATCATCCTGACGAGCAACCTCGCGACCGACAA
GATCACGAACATGACGATCGCCGCGCGGGAAGAGGACCCGGCGCGGCGGCTCGACGCCGACGGCGAGTTC
ATCAAGGAGGTGGTCGAGGCGATCAAGCCGACGCTCTCGGCGCACTTCAAGCCGGCGCTGCTCGCCCGCA
TGACGACGGTGCCGTACCTGCCGATCTCGCCCGACGCGCTCGGCGAGATCACCCGGCTCAAGCTGGACGC
GCTCGTCGATCGCCTGCGCAAGAGCCAGCGGATCGAGGCGTCGTACTCGGACGCGCTCGTCGACACGATC
GCCGCGCGCTGCACCGAGGTCGACACGGGCGCGCGCAACATCGATCACATCCTCCGGGCGTCGCTCCTGC
CGCAGCTCTCGGTCGCCGTCCTCGAGAAGATGGCGGAGGGCCCGCTCCCGAAGCGGCTCCAGATCGGGGT
CGACGCCGAGAAGAACTTCACCGTCTCGTTCTCGGACTAA