SecReT6
Protein ID: 521465254
SecReT6 ID815
T6SS typei1
Gene symbol-
Locus tagSCE1572_30320
StrainSorangium cellulosum So0157-2
Repliconchromosome [GenBank: NC_021658] [Browse all T6SS(s) in this replicon]
Location [Strand]8613678..8615360 [-]
Producthypothetical protein
NoteTssA
UniProt IDS4Y2J8
KEGG IDscu:SCE1572_30320
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.80E-18, Aligned region: 54..114
Protein Sequence: 560 a.a.     [Download]
>gi|521465254|ref|YP_008152452.1| hypothetical protein SCE1572_30320 [Sorangium cellulosum So0157-2]
MAAEDAIQKSKARIETLFAPIDGGVGADVTYDEAFEALKNEVDKLQSLSGGKVDWSRVATGADELLSEKS
KDFRVALYYAAAKAQLDRLPGLLDGLVLVQELNNAFWDTMYPALRRPKARGNLCTWFGDIAASTLAGVTP
SAAERDVVNAIDQVSRALDADLSNRLGEAYGGFGQLRSAIRSVVASLPAEAPPPPPPPPPPPPPPPKAAE
AAIVQAPAATPVIVTPPPAPPSPPPQVVVTSSPGLSLEAIVDEDSALTVLGRCAPLIARAGDALRATNPK
RAAAYRVLRIGLWIDILDDPGAGSPNSTTGVPPPPDHVQRALPALTSQRAFADLLPLVDEYAQSYPLWLD
PHRYAANALDQLGDDYAEARRAVLVEMGVLMLRAPLLATLKFNDGTPFADAETQTWLSNDVAAAFGAGGA
GAPARPRSYLDKPLSEARGLVANEQPVDAMVLLEKAAAAAPSALDRFRVRLAMAQINIDLSQFLVARAQL
EALEHIVEHHRLTTWQPDLCAELYAALHTCYRALNERDDATPEARAKEVLCFERVCQLDAALALKLSLGV
 
Nucleotide Sequence: 1683 bp     [Download]
>gi|521458881|ref|NC_021658.1|:c8615360-8613678 Sorangium cellulosum So0157-2, complete genome
ATGGCCGCTGAAGATGCCATCCAGAAATCCAAAGCGCGGATCGAGACGCTGTTCGCTCCCATCGACGGCG
GCGTCGGCGCCGACGTCACCTACGACGAGGCGTTCGAGGCCCTCAAGAACGAGGTCGACAAGCTGCAGTC
GCTCTCGGGCGGCAAGGTCGACTGGTCCCGCGTCGCGACCGGCGCCGACGAGCTCCTGAGCGAGAAGTCC
AAGGACTTCCGCGTCGCGCTCTACTACGCCGCGGCGAAGGCGCAGCTCGACAGGCTCCCCGGCCTGCTCG
ACGGGCTCGTGCTCGTGCAGGAGCTGAACAACGCGTTCTGGGACACGATGTACCCCGCGCTCCGGCGGCC
CAAGGCGCGCGGCAACCTGTGCACCTGGTTCGGCGACATCGCGGCCTCGACGCTCGCCGGCGTGACGCCC
TCCGCCGCGGAGCGCGACGTGGTGAACGCCATCGACCAGGTGAGCCGCGCCCTCGACGCCGACCTCAGCA
ACCGGCTCGGCGAGGCGTACGGCGGCTTCGGCCAGCTCCGGAGCGCGATCCGCAGCGTCGTCGCGAGCCT
CCCCGCCGAGGCGCCGCCGCCGCCGCCACCTCCGCCGCCGCCACCCCCGCCGCCGCCGAAGGCGGCCGAG
GCGGCGATCGTCCAGGCGCCGGCGGCCACCCCGGTGATCGTCACCCCGCCGCCGGCGCCGCCGTCGCCGC
CGCCGCAGGTCGTCGTCACGAGCAGCCCGGGGCTCAGCCTGGAGGCGATCGTCGACGAGGACTCCGCGCT
CACCGTCCTCGGCCGCTGCGCGCCCTTGATCGCGCGCGCGGGCGACGCGCTCCGGGCGACGAACCCGAAG
CGCGCGGCCGCGTACCGCGTCCTCCGCATCGGGCTCTGGATCGACATCCTCGACGACCCCGGGGCCGGAT
CCCCGAACAGCACCACGGGGGTCCCGCCGCCGCCCGATCACGTGCAGCGGGCGCTCCCGGCGCTGACGAG
CCAGAGGGCGTTCGCCGACCTCCTGCCGCTCGTCGACGAGTACGCGCAGAGCTACCCCCTCTGGCTCGAT
CCGCACCGGTACGCGGCGAACGCGCTCGATCAGCTCGGCGACGACTACGCCGAGGCCCGGCGGGCCGTGC
TCGTCGAGATGGGCGTCCTCATGCTCCGCGCGCCGCTCCTGGCGACGCTGAAGTTCAACGACGGCACGCC
GTTCGCGGACGCCGAGACGCAGACCTGGCTCTCGAACGACGTGGCGGCCGCCTTCGGCGCGGGGGGCGCC
GGCGCCCCCGCGAGGCCGCGGAGCTACCTCGACAAGCCGCTCTCCGAGGCCCGCGGGCTCGTCGCGAACG
AGCAGCCCGTCGACGCGATGGTCCTCCTCGAGAAGGCGGCGGCCGCCGCTCCGTCGGCGCTGGACCGCTT
CCGCGTGCGGCTCGCGATGGCGCAGATCAACATCGATCTGTCCCAGTTCCTCGTCGCGCGCGCGCAGCTC
GAGGCGCTGGAGCACATCGTCGAGCACCACCGACTCACCACCTGGCAGCCGGATCTCTGCGCGGAGCTCT
ACGCCGCGCTCCATACATGCTACCGGGCCCTGAACGAGCGCGACGACGCCACCCCCGAGGCCAGGGCGAA
GGAGGTGCTCTGCTTCGAGCGCGTCTGCCAGCTCGACGCTGCGCTCGCCCTGAAACTTTCGCTGGGGGTC
TGA