SecReT6
Protein ID: 521465258
SecReT6 ID815
T6SS typei1
Gene symbol-
Locus tagSCE1572_30340
StrainSorangium cellulosum So0157-2
Repliconchromosome [GenBank: NC_021658] [Browse all T6SS(s) in this replicon]
Location [Strand]8621261..8622622 [-]
Producthypothetical protein
NoteTssK
UniProt IDS4Y0Y4
KEGG IDscu:SCE1572_30340
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.90E-102, Aligned region: 19..449
Protein Sequence: 453 a.a.     [Download]
>gi|521465258|ref|YP_008152456.1| hypothetical protein SCE1572_30340 [Sorangium cellulosum So0157-2]
MIHPRKPVWTEGLFMTPQHLQQSDVYHETLLHARLHAVVGYDWGITSAQFDERALSAGQFKVVKCHGIFP
DGTPFFIGDRGEDQVEARPLEGAFPAALQDLDVYLGIPNLRETAANISLDPAKAGPAQRFVASQATVPDV
NSGRNDTSVTWARTNLRLIFGTEPRDAYQTVRIAQLTRDRSGAIVLRKSFIPSVLRINSSDHIMSGLRRV
LSALVGKQKSLVEGRRMRTAASVDFQASDLTKFWLLHTLNSYIPVVSHLVDHGRAHPEQCFVVIGSLIGE
LCTFSAADSDPTTIPKFNYLDLEGVLNPMFDRAVTLISGVVTDQFIIVPLEKREDGMYLGRFDDPKVPRT
HEMFLEAKGTDEATLRERLPRLLKIGSWTQIGHILHSATPGVNVAIEYRPPGAIPVKPGLVYLRVNQSGD
YWNDILGSGTIAIYQPIEPQKVDLRLIGVPTGK
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|521458881|ref|NC_021658.1|:c8622622-8621261 Sorangium cellulosum So0157-2, complete genome
ATGATCCACCCGCGTAAGCCTGTCTGGACCGAGGGGCTCTTCATGACCCCTCAGCATCTGCAGCAGTCGG
ACGTCTACCATGAGACGCTGCTCCACGCGCGCCTCCACGCGGTCGTGGGCTACGACTGGGGCATCACGTC
CGCGCAGTTCGACGAGCGAGCGCTCTCGGCCGGGCAGTTCAAGGTGGTCAAGTGCCACGGCATCTTCCCC
GACGGGACGCCGTTCTTCATCGGCGATCGCGGCGAGGACCAGGTCGAGGCGCGGCCGCTCGAGGGCGCCT
TCCCGGCCGCGCTGCAGGATCTCGACGTCTACCTCGGCATCCCGAACCTGCGCGAGACCGCGGCGAACAT
CAGCCTCGACCCGGCGAAGGCGGGGCCGGCCCAGCGGTTCGTGGCGTCCCAGGCGACGGTCCCGGACGTG
AACTCCGGGCGCAACGACACGTCGGTCACCTGGGCCCGCACCAACCTGCGGCTCATCTTCGGCACCGAGC
CGCGCGACGCGTACCAGACCGTGCGCATCGCGCAGCTCACCCGCGACCGCTCCGGCGCGATCGTCCTCCG
GAAGAGCTTCATCCCGTCGGTCCTCCGCATCAACTCGTCCGACCACATCATGTCCGGCCTCCGGCGCGTG
CTGTCGGCGCTGGTCGGCAAGCAGAAGTCGCTCGTCGAGGGGCGGCGCATGCGCACCGCGGCGTCGGTCG
ACTTCCAGGCCTCCGACCTCACGAAGTTCTGGCTGCTCCACACCCTGAACTCGTACATCCCGGTCGTGTC
GCACCTCGTCGACCACGGCCGCGCGCACCCGGAGCAGTGCTTCGTCGTCATCGGCTCGCTCATCGGCGAG
CTCTGCACCTTCTCGGCGGCCGACAGCGACCCGACGACGATCCCCAAGTTCAACTACCTCGACCTGGAGG
GCGTCCTCAACCCGATGTTCGATCGGGCGGTCACGCTCATCAGCGGGGTCGTCACGGACCAGTTCATCAT
CGTGCCGCTCGAGAAGCGCGAGGACGGCATGTACCTCGGCAGGTTCGACGACCCGAAGGTGCCGCGCACC
CACGAGATGTTCCTCGAGGCGAAGGGCACCGACGAGGCCACGCTGCGCGAGCGGCTCCCGCGCCTGCTCA
AGATCGGCTCGTGGACGCAGATCGGGCACATCCTGCACTCCGCGACGCCCGGCGTGAACGTCGCCATCGA
GTACCGGCCGCCGGGCGCGATCCCGGTCAAGCCGGGGCTCGTCTACCTCCGCGTCAACCAGTCCGGCGAT
TACTGGAACGACATCCTCGGCTCTGGCACGATCGCCATCTACCAGCCCATCGAACCGCAGAAGGTCGACC
TCCGGCTGATCGGGGTCCCGACGGGGAAGTGA