SecReT6
Protein ID: 521465259
SecReT6 ID815
T6SS typei1
Gene symbol-
Locus tagSCE1572_30345
StrainSorangium cellulosum So0157-2
Repliconchromosome [GenBank: NC_021658] [Browse all T6SS(s) in this replicon]
Location [Strand]8622772..8623563 [-]
Producthypothetical protein
NoteTssJ
UniProt IDS4Y2K4
KEGG IDscu:SCE1572_30345
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.60E-31, Aligned region: 68..195
Protein Sequence: 263 a.a.     [Download]
>gi|521465259|ref|YP_008152457.1| hypothetical protein SCE1572_30345 [Sorangium cellulosum So0157-2]
MVAFAKLLQRSMWLGEPRSPSPAGEGPPRRPAPRPGPASLARGAAAGKVAAAVAAATLAAAVFAGLPAAV
AGCTSPAPPPAAPEPCDVQIVTLSIYASDNINPNENGNPRPVVVRLYQLKSSARMENATYDQILLRDKET
LEDDLAKVDEVEVFPNDLVEVKFERLPDASHLVGAALFHSPKGSSWKTFYEFPLPPGEAQCGGRESDAGP
PVADPRVAFFIDSTKIDNGVEMDESMFPNATAVRRLNLPKKAAAPEAPSAPRR
 
Nucleotide Sequence: 792 bp     [Download]
>gi|521458881|ref|NC_021658.1|:c8623563-8622772 Sorangium cellulosum So0157-2, complete genome
ATGGTCGCGTTCGCCAAGCTCCTACAGCGTTCGATGTGGCTCGGGGAGCCGCGTTCGCCCTCCCCCGCGG
GGGAGGGCCCGCCGCGCAGGCCGGCGCCTCGACCCGGGCCGGCGTCGCTCGCCCGCGGGGCGGCCGCGGG
GAAGGTCGCCGCTGCCGTCGCGGCGGCGACGCTCGCCGCCGCCGTGTTCGCCGGACTGCCCGCCGCGGTG
GCGGGCTGCACGTCCCCCGCGCCGCCGCCCGCCGCCCCCGAGCCGTGCGACGTCCAGATCGTGACGCTGT
CGATCTACGCGTCCGACAACATCAACCCCAACGAGAACGGCAACCCGCGGCCCGTCGTCGTGCGGCTCTA
CCAGCTGAAGAGCAGCGCGCGCATGGAGAACGCGACGTACGATCAGATCCTGCTCCGGGACAAGGAGACG
CTCGAGGACGACCTCGCCAAGGTCGACGAGGTCGAGGTCTTCCCGAACGACCTCGTCGAGGTGAAGTTCG
AGCGCCTGCCGGACGCGAGCCACCTCGTCGGCGCCGCCCTGTTCCACAGCCCGAAGGGGAGCAGCTGGAA
GACGTTCTACGAGTTCCCGCTGCCGCCCGGAGAGGCCCAGTGCGGCGGGCGCGAGAGCGACGCGGGGCCG
CCCGTGGCCGACCCGCGGGTCGCGTTCTTCATCGACTCGACGAAGATCGACAACGGGGTCGAGATGGACG
AGTCGATGTTCCCGAACGCGACCGCCGTGCGGCGGCTCAACCTGCCGAAGAAGGCGGCCGCGCCGGAGGC
GCCGTCCGCGCCGAGGAGGTAG