SecReT6
Protein ID: 521465263
SecReT6 ID815
T6SS typei1
Gene symbol-
Locus tagSCE1572_30370
StrainSorangium cellulosum So0157-2
Repliconchromosome [GenBank: NC_021658] [Browse all T6SS(s) in this replicon]
Location [Strand]8632161..8632640 [+]
Producthypothetical protein
NoteTssD
UniProt IDS4Y0Y9
KEGG IDscu:SCE1572_30370
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.30E-34, Aligned region: 7..142
Protein Sequence: 159 a.a.     [Download]
>gi|521465263|ref|YP_008152462.1| hypothetical protein SCE1572_30370 [Sorangium cellulosum So0157-2]
MEGVTQGPIHGSVTQAKRENTIAVISVQHQVVSPRDPATGLPSGKRQHKPFVITKELDKATPLLYNALVN
NESIKTWELKFYTPGAKAINNDGKEKNHYSVKLTNATVASIDFHMENTRRDAQTPEYEKVAFTYQKIEWS
YDDGSGARQADDDWETPNQ
 
Nucleotide Sequence: 480 bp     [Download]
>gi|521458881|ref|NC_021658.1|:8632161-8632640 Sorangium cellulosum So0157-2, complete genome
TTGGAGGGTGTTACGCAGGGCCCGATTCACGGCTCGGTCACCCAGGCTAAGCGCGAGAACACGATCGCCG
TCATCTCCGTGCAGCATCAGGTCGTGAGCCCGCGCGATCCGGCGACCGGGTTGCCCAGCGGCAAGCGGCA
GCACAAGCCCTTCGTGATCACGAAGGAGCTCGATAAGGCGACCCCGCTCCTCTACAACGCCCTGGTCAAC
AACGAGAGCATCAAGACGTGGGAGCTCAAGTTCTACACGCCGGGCGCCAAGGCGATCAACAACGACGGTA
AGGAGAAGAACCACTACTCCGTCAAGCTCACGAACGCGACGGTCGCGAGCATCGACTTCCACATGGAGAA
CACCCGGCGGGACGCGCAGACGCCGGAGTACGAGAAGGTCGCCTTCACGTACCAGAAGATCGAGTGGTCG
TACGACGACGGCAGCGGCGCCCGCCAGGCGGACGACGACTGGGAGACGCCGAACCAGTAG