SecReT6
Protein ID: 521465264
SecReT6 ID815
T6SS typei1
Gene symbol-
Locus tagSCE1572_30375
StrainSorangium cellulosum So0157-2
Repliconchromosome [GenBank: NC_021658] [Browse all T6SS(s) in this replicon]
Location [Strand]8632920..8633270 [+]
Producthypothetical protein
NoteTssD
UniProt IDS4Y2L0
KEGG IDscu:SCE1572_30375
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.50E-21, Aligned region: 2..101
DUF995 [PF06191], Evalue: 0.0057, Aligned region: 59..105
Protein Sequence: 116 a.a.     [Download]
>gi|521465264|ref|YP_008152463.1| hypothetical protein SCE1572_30375 [Sorangium cellulosum So0157-2]
MTGRPTGKRMHKPFIVTKDLDRSTPLLLSMLSHNESIPRWELQFYRSVAIGIEKPVFTVQLTNATISSIQ
FHMLNVRHPSQARVPEQEEVAFTYQKVLWIWNDGGLSAEDDWLTPR
 
Nucleotide Sequence: 351 bp     [Download]
>gi|521458881|ref|NC_021658.1|:8632920-8633270 Sorangium cellulosum So0157-2, complete genome
GTGACCGGCCGCCCGACGGGCAAGCGGATGCACAAGCCCTTCATCGTCACGAAGGACCTCGACCGGTCCA
CCCCGCTCCTCCTCAGCATGCTCAGCCACAACGAGAGCATCCCCCGCTGGGAGCTCCAGTTCTACCGGTC
GGTCGCGATCGGCATCGAGAAGCCGGTCTTCACGGTCCAGCTCACGAACGCGACCATCTCGAGCATCCAG
TTCCACATGCTCAACGTGCGGCACCCGTCGCAAGCGCGCGTGCCCGAGCAGGAGGAGGTCGCGTTCACGT
ACCAGAAGGTGCTCTGGATCTGGAACGACGGCGGCCTCTCGGCCGAGGACGACTGGCTCACCCCGCGCTG
A