SecReT6
Protein ID: 521465266
SecReT6 ID815
T6SS typei1
Gene symbol-
Locus tagSCE1572_30385
StrainSorangium cellulosum So0157-2
Repliconchromosome [GenBank: NC_021658] [Browse all T6SS(s) in this replicon]
Location [Strand]8633814..8635583 [+]
Producthypothetical protein
NoteTssF
UniProt IDS4XYX0
KEGG IDscu:SCE1572_30385
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.20E-180, Aligned region: 2..588
Protein Sequence: 589 a.a.     [Download]
>gi|521465266|ref|YP_008152465.1| hypothetical protein SCE1572_30385 [Sorangium cellulosum So0157-2]
MFNKYYQDELTYLRDLGREFAAAYPGIAPMLAERGGDPDVERLLEGVAFLTGKIRQKLDDELPEVIHSVA
SLLFPHYLRQIPATSIIEFTPLPNVVRERLVVARHAEVGSVPVDGVSCRFRTTQDVELVPLAVEDVRVDT
GAQLAQTLRIELRLTGGAALAGLSLSSLRFYIHGERRLQDDLRLWVGAHVDTVALAAVDASGRDTTIASL
PGRAVRLTGFTDEEALIPYPKTVYPGFRLLQEFFTLPQKFAFFEVTGLQALSAERISDRFAILLQFRDGL
PPGTRVSRENLRLFCSPVVNLFEHTSDPIKPEATKHEYLCRPAGATPAAFEIHSIDKVVGIARRTSQRVE
IPSFFSFQHELDPEAAARTIFYQTHLRPAAIGDGIDMYLSFGSPQDAGALPEFDVISIEATSTNRRLPAQ
LKLGDLRVPTATSPAVASFTNLTGVTAPLPPPIGRELQWRVLAHMAMSYRSITDLEVLRATVDLYNFQAI
VDRQAARANQLRLAAIKSIRVRPTDRLYRGAPVRGVAVDVELDEGGFVGEGEMYLFASILNEMLGSYVSL
NSFTQLTVTGTNTRVVHKWEPKSGSLTLI
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|521458881|ref|NC_021658.1|:8633814-8635583 Sorangium cellulosum So0157-2, complete genome
ATGTTCAACAAGTACTACCAGGACGAGCTCACCTACCTGAGGGACCTGGGGCGGGAGTTCGCCGCGGCCT
ACCCCGGGATCGCGCCCATGCTCGCGGAGCGCGGCGGCGACCCGGACGTCGAGCGCCTGCTCGAGGGCGT
CGCCTTCCTGACGGGCAAGATCCGCCAGAAGCTCGACGACGAGCTCCCCGAGGTGATCCACTCGGTCGCG
TCGCTGCTCTTTCCGCATTACCTCCGTCAGATCCCGGCGACGTCGATCATCGAGTTCACGCCGCTGCCGA
ACGTCGTGCGCGAGAGGCTCGTCGTGGCCCGGCACGCGGAGGTCGGGTCGGTGCCGGTCGACGGCGTCTC
GTGCCGGTTCCGCACCACGCAGGACGTCGAGCTCGTCCCGCTCGCGGTGGAGGACGTGCGCGTCGACACC
GGCGCGCAGCTCGCGCAGACGCTCCGCATCGAGCTCCGCCTGACCGGGGGCGCCGCGCTCGCGGGCCTGT
CGCTCTCGTCGCTCCGCTTCTACATCCACGGCGAGCGTCGGCTCCAGGACGACCTCCGCCTCTGGGTCGG
CGCGCACGTCGACACCGTCGCGCTCGCCGCCGTGGACGCGTCCGGGCGCGACACGACGATCGCGTCGCTC
CCGGGGCGCGCCGTGCGGCTCACCGGCTTCACCGACGAAGAGGCGCTGATCCCGTACCCGAAGACGGTCT
ACCCGGGCTTCCGGCTCCTGCAGGAGTTCTTCACGCTCCCGCAGAAGTTCGCGTTCTTCGAGGTGACCGG
CCTCCAGGCGCTCTCGGCGGAGCGGATCTCCGACCGCTTCGCGATCTTGCTGCAGTTCAGGGACGGGCTC
CCGCCGGGGACCCGCGTCAGCCGGGAGAACCTCCGGCTGTTCTGCTCGCCGGTCGTGAACCTGTTCGAGC
ACACGAGCGATCCGATCAAGCCCGAGGCCACCAAGCACGAGTACCTGTGCCGCCCCGCGGGCGCGACGCC
CGCGGCCTTCGAGATCCACAGCATCGACAAGGTCGTCGGGATCGCCCGCCGCACGAGCCAGCGCGTCGAG
ATCCCCTCGTTCTTCAGCTTCCAGCACGAGCTCGATCCCGAGGCCGCCGCGCGGACGATCTTCTACCAGA
CGCACCTCCGCCCGGCCGCGATCGGCGACGGCATCGACATGTACCTGTCGTTCGGCTCGCCGCAGGACGC
CGGGGCGCTCCCCGAGTTCGACGTGATCAGCATCGAGGCGACGAGCACGAACCGCCGCCTGCCGGCGCAG
CTGAAGCTCGGCGATCTGCGGGTGCCGACGGCGACCTCCCCCGCGGTGGCGAGCTTCACGAACCTCACGG
GCGTCACCGCGCCGCTCCCGCCGCCGATCGGGCGCGAGCTGCAGTGGCGCGTGCTGGCCCACATGGCGAT
GAGCTACCGCTCGATCACCGATCTCGAGGTGCTCCGGGCGACGGTCGATCTCTACAACTTCCAGGCGATC
GTCGATCGCCAGGCGGCGCGCGCGAACCAGCTCCGCCTGGCCGCGATCAAGTCGATCCGGGTGCGGCCGA
CCGACCGGCTGTACCGGGGCGCGCCGGTGCGCGGCGTCGCGGTCGACGTCGAGCTCGACGAGGGCGGGTT
CGTCGGCGAGGGCGAGATGTACCTGTTCGCGAGCATCCTCAACGAGATGCTCGGGTCCTACGTCTCGTTG
AACTCGTTCACGCAGCTGACGGTCACCGGCACGAACACACGCGTGGTGCACAAATGGGAGCCGAAGAGCG
GCAGCCTGACGCTGATCTGA