SecReT6
Protein ID: 521465267
SecReT6 ID815
T6SS typei1
Gene symbol-
Locus tagSCE1572_30390
StrainSorangium cellulosum So0157-2
Repliconchromosome [GenBank: NC_021658] [Browse all T6SS(s) in this replicon]
Location [Strand]8635547..8636680 [+]
Producthypothetical protein
NoteTssG
UniProt IDS4Y689
KEGG IDscu:SCE1572_30390
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-76, Aligned region: 36..342
Protein Sequence: 377 a.a.     [Download]
>gi|521465267|ref|YP_008152466.1| hypothetical protein SCE1572_30390 [Sorangium cellulosum So0157-2]
MGAEERQPDADLRAAATRGAAAADPAALEALRRLAQTAPRFSYYRLVYLLERLFPASPPVGQLGPVQDER
IRLRGDPSLVFASSDVSELAPVKYADGVQRARVSTTFLGLYGSVSPLPAYFIEQIALADYQGGPQPVREL
LDVLHHRLLSLLYRAWTKYRLPVTYRKQGADPFSRRMLCAVGLDGFRDYETPLDRFFFLRYAPILASKSR
SARNLETVLSEMLGDIGVKIEQFVGHWTKIEKPFRNKLGVMNHQLGESLTLGRYVFDGSGRYKVVLGPVG
YDEYLSFLPGGQRQELVRGIIETFTPGIHDVMLEIHVDTEEAPRFQLGSPRASTLKRTAWIGGSAAERLV
ITIPLDDKHLAGGDDEDDEDRGEPPPM
 
Nucleotide Sequence: 1134 bp     [Download]
>gi|521458881|ref|NC_021658.1|:8635547-8636680 Sorangium cellulosum So0157-2, complete genome
ATGGGAGCCGAAGAGCGGCAGCCTGACGCTGATCTGAGGGCGGCCGCGACGAGGGGCGCCGCGGCCGCCG
ACCCCGCGGCGCTGGAGGCGCTCCGGCGCCTCGCGCAGACCGCGCCGCGCTTCTCGTACTACCGCCTCGT
CTACCTGCTCGAGCGGCTCTTCCCCGCCTCGCCGCCGGTGGGCCAGCTCGGGCCGGTGCAGGACGAGCGC
ATCCGGCTGCGCGGCGATCCGTCGCTCGTCTTCGCGTCGAGCGACGTGAGCGAGCTCGCGCCGGTCAAGT
ACGCGGACGGGGTCCAGCGGGCGCGGGTCTCGACCACGTTCCTCGGCCTGTACGGCTCGGTGTCGCCGCT
GCCGGCGTACTTCATCGAGCAGATCGCGCTGGCCGACTACCAGGGCGGGCCGCAGCCGGTCCGCGAGCTC
CTCGACGTCCTCCACCACCGGCTCCTGTCGCTGCTCTACCGCGCGTGGACCAAGTACCGGCTGCCCGTCA
CGTACCGCAAGCAGGGCGCCGATCCGTTCTCGCGCCGGATGCTCTGCGCCGTCGGCCTCGACGGGTTCCG
CGACTACGAGACGCCGCTCGACCGCTTCTTCTTCCTCCGGTACGCGCCGATCCTCGCCTCGAAGTCGCGC
TCGGCGCGGAACCTCGAGACGGTGCTCTCCGAGATGCTCGGGGACATCGGCGTGAAGATCGAGCAGTTCG
TCGGCCACTGGACGAAGATCGAGAAGCCGTTCAGGAACAAGCTCGGCGTGATGAACCACCAGCTCGGCGA
GAGCCTGACGCTGGGGCGCTACGTGTTCGACGGGTCGGGCCGCTACAAGGTCGTGCTCGGCCCGGTCGGC
TACGACGAGTACCTCTCGTTCCTGCCCGGCGGCCAGCGTCAGGAGCTCGTCCGCGGCATCATCGAGACGT
TCACGCCGGGCATCCACGACGTGATGCTCGAGATCCACGTGGACACGGAGGAGGCGCCGCGGTTCCAGCT
CGGCTCGCCGCGCGCCTCGACGCTCAAGCGCACCGCGTGGATCGGCGGCTCCGCGGCGGAGCGGCTCGTG
ATCACGATCCCCCTCGACGACAAGCACCTCGCGGGCGGCGACGACGAGGACGACGAGGATCGGGGCGAGC
CCCCGCCGATGTGA