SecReT6
Protein ID: 523522845
SecReT6 ID816
T6SS typei4b
Gene symbol-
Locus tagBJAB07104_01461
StrainAcinetobacter baumannii BJAB07104
Repliconchromosome [GenBank: NC_021726] [Browse all T6SS(s) in this replicon]
Location [Strand]1534705..1535208 [+]
ProductHemolysin-coregulated protein (uncharacterized)
NoteTssD
UniProt IDS5DBZ6
KEGG IDabj:BJAB07104_01461
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.30E-43, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|523522845|ref|YP_008208924.1| Hemolysin-coregulated protein (uncharacterized) [Acinetobacter baumannii BJAB07104]
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATS
PKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYN
QQDINGTAKGAVTKKWSLSNNTASYAA
 
Nucleotide Sequence: 504 bp     [Download]
>gi|523521389|ref|NC_021726.1|:1534705-1535208 Acinetobacter baumannii BJAB07104, complete genome
ATGAAAGATATATACGTTGAGTTTCGCGGTAAATATAAAGTTGATGGAGAATCTCGTGATTCTGAGCACA
AAGGTTGGTTAGAAGTTAACTCTTGGTCTCATAACATCCGTCAACCTAAATCTGCTACTTCAAGTAGTGT
AGGCGGCCACACTGCTGAACGTGTTGAACATTCTGACATGGTTTTCGTGAAAGACTTAGACGCAACTAGC
CCTAAATTATGGGAAGCTTGTTCAGCTGGTTATACATTTGATGAAGTACAAATCGACTTCTATCGCGCAA
ATGGCGATAAACGTATCAAGTACTTACAAATCAAATTGAAGCACGTTTTAGTTTCTAGTGTGACTCCAAC
TGTTAACGAAGAAGGCGTTCCTACAGAAGCATTCGGTTTGAAATATGCTGCTGTTGAGTGGACTTATAAC
CAACAAGATATTAACGGTACTGCTAAAGGTGCTGTTACTAAGAAATGGTCACTTTCTAATAATACAGCTT
CTTACGCAGCGTAA