SecReT6
Protein ID: 523522846
SecReT6 ID816
T6SS typei4b
Gene symbol-
Locus tagBJAB07104_01462
StrainAcinetobacter baumannii BJAB07104
Repliconchromosome [GenBank: NC_021726] [Browse all T6SS(s) in this replicon]
Location [Strand]1535288..1535764 [+]
Producthypothetical protein
NoteTssE
UniProt IDS5D8V5
KEGG IDabj:BJAB07104_01462
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-18, Aligned region: 32..135
Protein Sequence: 158 a.a.     [Download]
>gi|523522846|ref|YP_008208925.1| hypothetical protein BJAB07104_01462 [Acinetobacter baumannii BJAB07104]
MNLDRLYPYGFRSTLFDRLIPESEDYAKGLSIQQLRESVAKDLEDLLNSRVAKLDHVIDDYPLVKKSILQ
FGIIDFVGLSTANPLDRDKICQSIEQSIAAHEPRLRQIRVEMLLDGHNMGALCLSIQAYLNIHPLYEPVV
FDALLKPTTQQYVISART
 
Nucleotide Sequence: 477 bp     [Download]
>gi|523521389|ref|NC_021726.1|:1535288-1535764 Acinetobacter baumannii BJAB07104, complete genome
ATGAACTTAGATCGGCTTTATCCATACGGATTTCGTTCAACTTTATTTGATCGTTTAATTCCAGAAAGTG
AAGATTATGCAAAAGGTCTTTCTATTCAGCAATTAAGAGAATCTGTAGCAAAGGATTTAGAAGATTTGCT
CAATAGTCGGGTAGCAAAGTTAGATCATGTGATTGATGACTATCCACTTGTAAAAAAATCGATACTTCAG
TTCGGGATTATTGATTTTGTGGGGCTTTCTACAGCCAACCCTCTGGATCGGGATAAAATTTGCCAATCCA
TTGAGCAATCAATAGCAGCTCATGAACCTCGGCTAAGACAAATACGGGTAGAGATGTTATTAGATGGACA
TAATATGGGCGCATTATGTTTAAGTATTCAGGCTTATCTAAATATTCACCCCTTATATGAACCTGTTGTA
TTTGATGCATTGTTAAAACCAACAACGCAGCAATATGTAATTTCAGCAAGAACTTAA