SecReT6
Protein ID: 523522847
SecReT6 ID816
T6SS typei4b
Gene symbol-
Locus tagBJAB07104_01463
StrainAcinetobacter baumannii BJAB07104
Repliconchromosome [GenBank: NC_021726] [Browse all T6SS(s) in this replicon]
Location [Strand]1535781..1537592 [+]
Producthypothetical protein
NoteTssF
UniProt IDS5DDQ7
KEGG IDabj:BJAB07104_01463
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.90E-156, Aligned region: 5..603
Protein Sequence: 603 a.a.     [Download]
>gi|523522847|ref|YP_008208926.1| hypothetical protein BJAB07104_01463 [Acinetobacter baumannii BJAB07104]
MIEELLPFYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARIDKKLTDSYDV
FTRSLFEVMFPQYLRHFPACSVVSFEDINKIKQLTEPHLVPHHTVLKSRSFKGVQCEFNTTQEVKLLPIH
LSGLDFKTTPSAHMHLNQNATLSLKFEIFNNAHACLTDEKLPIYLDAISNFPLQVLDSIFKKGTSFAVKY
GQTIVELSKNPFELIGFAEQESLLPLDQHTHHAYRLLMEYFCFPEKFSYLKLDLDFLRRLPQHVSEFELL
IHFKLNLNDQAVVRNYSELNIANFKLFTTPVINLFEKYAEPQKIVHKQLEYPLVTDAHHPEFYQVYSILE
MNMVREKTNQEESYVPVLPFFAMSHYHNDTARFFYSVNYQKLQSNFVEMGYSIISKNLNPFSTRSDFIST
KLLCSNRDLPHEALGQSNNVLNLNDSSLARRAIVLKRPTKPYKFEQGQSEQWRVISHLSLNSLALMKGDA
VSHVKELLALYNLPQSKENYLIIESIKKLEFSLTHKLVDGKPFPMFVRGVKAELQIDSSVFRGHSLYIFS
QLLSRVFNLKVQINSFVDLVVKDYSSQQELYQCSQNVGGKTLL
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|523521389|ref|NC_021726.1|:1535781-1537592 Acinetobacter baumannii BJAB07104, complete genome
GTGATAGAAGAGCTTTTACCGTTTTATGAAAAACAATTACAAGAATTTGGTCAACAATCTCGAGAATTTG
CCCAAAAATATCCAAAAATTGCTCAGCGCTTATCTTTAAATCAAGAGCAAATTGATGACCCACATATTGA
ACGTCTGATTCAGGCTTTTTCGCTGATTGCTGCTCGAATCGATAAAAAACTAACAGACAGTTACGATGTT
TTTACTCGTTCTTTATTTGAGGTGATGTTCCCTCAATACTTACGGCATTTTCCTGCGTGTTCAGTTGTTA
GCTTTGAAGATATTAATAAGATTAAACAGCTTACAGAACCTCATCTTGTACCTCATCATACGGTTTTGAA
ATCTCGTAGTTTCAAAGGAGTACAGTGTGAGTTTAATACAACTCAAGAGGTTAAATTACTACCTATTCAT
TTAAGTGGTTTAGATTTTAAAACTACACCTAGTGCACATATGCACTTAAATCAAAATGCGACGTTGAGCC
TTAAATTTGAAATTTTTAATAATGCTCATGCTTGTTTAACTGATGAGAAGCTTCCTATTTATTTGGATGC
TATCTCTAATTTTCCTCTACAGGTCCTTGATAGTATTTTCAAAAAAGGAACCAGTTTTGCGGTTAAATAT
GGACAAACAATTGTAGAATTGAGCAAGAATCCATTTGAATTGATTGGTTTTGCAGAACAAGAAAGTTTAT
TACCGCTTGATCAACATACCCATCATGCTTATCGTTTGTTGATGGAATACTTTTGTTTCCCGGAAAAGTT
TAGTTATCTTAAGCTCGATTTGGATTTTTTAAGGCGACTACCTCAGCATGTATCCGAATTTGAGCTTTTA
ATTCATTTCAAATTAAACTTAAATGATCAAGCCGTTGTTAGAAACTATTCTGAGCTAAATATTGCAAACT
TTAAATTATTTACTACCCCCGTAATTAATTTATTTGAAAAATATGCTGAACCCCAGAAGATAGTTCACAA
GCAATTAGAATATCCTTTAGTTACAGACGCTCACCATCCTGAATTTTATCAAGTATATTCAATACTTGAG
ATGAATATGGTGCGTGAAAAAACAAATCAGGAAGAAAGCTATGTTCCTGTTTTGCCTTTTTTTGCGATGA
GCCATTACCACAATGATACAGCTCGCTTTTTTTACTCAGTAAACTATCAAAAGTTACAGTCCAATTTCGT
TGAAATGGGCTATTCGATTATTTCTAAAAATTTAAATCCATTTTCAACGCGCTCAGATTTTATTAGCACT
AAATTATTATGTTCAAACCGTGATTTACCTCATGAAGCACTGGGTCAGTCTAATAACGTATTAAATTTAA
ATGATAGTAGCTTGGCGAGACGTGCCATTGTTTTAAAACGACCTACAAAGCCTTATAAGTTTGAACAAGG
CCAAAGTGAACAGTGGCGTGTGATCTCGCATCTTTCATTAAATAGCTTAGCACTTATGAAAGGGGATGCT
GTTTCTCATGTTAAAGAGCTGCTGGCTTTATATAACTTACCGCAGTCAAAAGAAAACTATTTAATTATAG
AATCAATTAAAAAATTAGAATTTTCTCTTACCCATAAACTCGTAGATGGCAAACCATTTCCAATGTTTGT
AAGAGGAGTAAAAGCTGAATTACAAATTGATTCATCCGTATTTAGAGGGCATAGCTTATATATTTTTAGT
CAGTTATTAAGTCGTGTTTTTAATTTAAAGGTTCAAATTAATAGTTTTGTTGATTTGGTGGTTAAGGATT
ATTCATCTCAGCAGGAGTTATACCAATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAA