SecReT6
Protein ID: 523522848
SecReT6 ID816
T6SS typei4b
Gene symbol-
Locus tagBJAB07104_01464
StrainAcinetobacter baumannii BJAB07104
Repliconchromosome [GenBank: NC_021726] [Browse all T6SS(s) in this replicon]
Location [Strand]1537556..1538554 [+]
Producthypothetical protein
NoteTssG
UniProt IDS5D8R5
KEGG IDabj:BJAB07104_01464
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.90E-63, Aligned region: 18..312
Protein Sequence: 332 a.a.     [Download]
>gi|523522848|ref|YP_008208927.1| hypothetical protein BJAB07104_01464 [Acinetobacter baumannii BJAB07104]
MQSERWWQDSSVTAELFQRPKSFEFIQATRLLRHMPANDAALSWSDHFKFETSFNLNFPATEIESLELVD
ERVHLTNLIVGLTGIQGALPYTYTNKIKQAPRQQRAETKEFLSLFNHKLTSQYVESSIPYHLPVRYEIEN
KNDYLDILHALNGYVRSQHQQQDLDEYFAEFSGLMQGQNNTVHALKTMLSCIFKHEITIKEFVQESFKLA
GDQLTTLGGSQPSLLGINTFCGETIQQIDGKIEIQIGPLKRQQYLKFLPHQELSLKLKKIVETWCSPTLS
IDLRLILDETEIQPVRLTQGQESGLGQGAFLMSRKPNTHNDETCYSLIGEQI
 
Nucleotide Sequence: 999 bp     [Download]
>gi|523521389|ref|NC_021726.1|:1537556-1538554 Acinetobacter baumannii BJAB07104, complete genome
ATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAACGGCTGAGTTGTTTCAACGCCCTAAGTCTTTTG
AGTTTATTCAAGCAACACGTTTATTGCGTCATATGCCTGCCAATGACGCAGCTTTATCATGGTCTGACCA
TTTTAAATTTGAGACCTCATTTAACTTAAACTTTCCAGCCACTGAAATTGAAAGTTTAGAGTTAGTAGAT
GAACGTGTTCATTTAACAAACCTGATCGTTGGTCTGACTGGTATACAAGGTGCATTACCTTATACATATA
CAAATAAAATTAAGCAGGCTCCAAGGCAACAACGCGCTGAAACGAAAGAGTTTTTAAGCTTATTTAATCA
TAAGCTGACCAGTCAGTATGTAGAGTCAAGTATTCCTTATCACTTGCCTGTGCGCTATGAAATTGAAAAT
AAAAATGATTATTTGGATATTCTCCATGCATTGAATGGTTATGTTCGCTCACAACATCAGCAACAAGACT
TGGATGAATATTTCGCTGAATTTTCAGGCCTAATGCAGGGGCAAAATAATACGGTTCATGCTTTAAAGAC
GATGTTGAGTTGTATTTTTAAGCATGAAATTACAATTAAAGAGTTTGTACAGGAATCGTTTAAGTTAGCG
GGTGATCAGCTAACCACTTTAGGCGGAAGTCAACCGAGCTTACTTGGTATTAACACATTTTGTGGGGAAA
CGATTCAACAAATTGATGGAAAAATTGAGATTCAAATAGGTCCGCTTAAGCGTCAGCAATATTTAAAATT
TTTACCTCATCAAGAGCTTAGCTTAAAGCTCAAAAAAATCGTAGAAACCTGGTGCAGTCCAACTTTATCG
ATAGATTTAAGATTGATATTGGATGAGACTGAAATACAACCTGTTCGCTTAACTCAAGGCCAAGAAAGTG
GTTTAGGGCAAGGCGCTTTTTTAATGTCTCGTAAGCCTAATACACATAACGATGAAACATGTTATAGCCT
TATTGGAGAGCAAATATGA