SecReT6
Protein ID: 523522852
SecReT6 ID816
T6SS typei4b
Gene symbol-
Locus tagBJAB07104_01468
StrainAcinetobacter baumannii BJAB07104
Repliconchromosome [GenBank: NC_021726] [Browse all T6SS(s) in this replicon]
Location [Strand]1544818..1545585 [+]
ProductOuter membrane protein-related peptidoglycan-associated (lipo)protein
NoteTagL
UniProt IDS5DDR4
KEGG IDabj:BJAB07104_01468
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.20E-24, Aligned region: 21..44
OmpA [PF00691], Evalue: 1.20E-24, Aligned region: 154..248
BON [PF04972], Evalue: 0.0046, Aligned region: 31..66
Protein Sequence: 255 a.a.     [Download]
>gi|523522852|ref|YP_008208931.1| Outer membrane protein-related peptidoglycan-associated (lipo)protein [Acinetobacter baumannii BJAB07104]
MNQKYQIKLSQLIKGCFIYAIANYALAQPIVVEGVVPNEASKQAILMKMQSVYGADQVVDKIQVRPVAAP
NGWSDSVTRVITPDLKKVSQGKLSVNGTRFELTGKMLNPTEIQPTIQSFQSLVQPPYQLFSQLSVNQAEQ
KIIDDALKNRIIEFESGSAVLTEAGQKILDEMAVALNKVGGKKVKIVGHTDSSGDATKNLKLSQDRALAV
KNYLISKNIPADHLSTEGLGSSKPVADNTSAEGRKKNRRIEFTVL
 
Nucleotide Sequence: 768 bp     [Download]
>gi|523521389|ref|NC_021726.1|:1544818-1545585 Acinetobacter baumannii BJAB07104, complete genome
ATGAATCAAAAATATCAAATTAAACTTTCACAACTTATAAAAGGCTGTTTTATATATGCAATTGCGAATT
ATGCTTTAGCACAGCCTATAGTTGTAGAAGGTGTAGTGCCAAATGAAGCAAGTAAACAGGCTATTTTAAT
GAAAATGCAGTCTGTTTATGGTGCAGATCAGGTTGTCGATAAAATACAAGTTCGACCAGTTGCCGCTCCA
AATGGATGGAGTGACTCTGTCACACGAGTGATTACACCTGATCTTAAAAAAGTTTCTCAGGGTAAGTTAA
GTGTTAATGGAACCCGATTTGAACTGACCGGGAAAATGCTAAATCCGACAGAAATACAGCCAACCATTCA
GTCTTTTCAGAGTTTGGTACAGCCTCCATATCAATTATTTTCCCAGCTTTCTGTAAATCAGGCTGAGCAG
AAGATTATTGATGATGCTTTAAAAAATCGAATTATTGAATTTGAATCTGGTAGTGCAGTATTAACTGAAG
CTGGGCAAAAAATTCTTGATGAAATGGCTGTGGCTTTAAATAAAGTGGGCGGGAAAAAAGTCAAAATTGT
GGGGCATACCGATAGTTCTGGTGATGCGACCAAAAACTTAAAACTCAGCCAAGATCGAGCTTTAGCAGTT
AAAAATTATTTAATTAGTAAGAATATTCCTGCTGATCATTTATCTACCGAAGGTTTAGGTTCATCTAAGC
CTGTAGCGGACAATACTTCTGCGGAAGGTAGGAAGAAAAACCGCCGAATTGAGTTCACCGTTTTATAG