SecReT6
Protein ID: 523522853
SecReT6 ID816
T6SS typei4b
Gene symbol-
Locus tagBJAB07104_01469
StrainAcinetobacter baumannii BJAB07104
Repliconchromosome [GenBank: NC_021726] [Browse all T6SS(s) in this replicon]
Location [Strand]1545602..1545865 [+]
Producthypothetical protein
NotePAAR
UniProt IDS5D8R9
KEGG IDabj:BJAB07104_01469
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.10E-21, Aligned region: 7..79
Protein Sequence: 87 a.a.     [Download]
>gi|523522853|ref|YP_008208932.1| hypothetical protein BJAB07104_01469 [Acinetobacter baumannii BJAB07104]
MASPYITIGCPTTGGGQVISGNSAFLIEGIAIACVGDKATCPAHKTVSTIVSGDPNMQVMGKAAARVNDS
LSCGCKLLPKQSLVNQG
 
Nucleotide Sequence: 264 bp     [Download]
>gi|523521389|ref|NC_021726.1|:1545602-1545865 Acinetobacter baumannii BJAB07104, complete genome
ATGGCTAGCCCTTACATTACGATTGGATGCCCAACGACAGGTGGAGGGCAAGTCATTTCTGGTAATAGTG
CATTTTTAATTGAGGGAATCGCAATTGCATGTGTAGGTGATAAAGCAACTTGTCCGGCGCATAAAACGGT
TTCTACGATTGTTTCCGGTGACCCAAATATGCAAGTGATGGGAAAAGCAGCAGCAAGAGTAAATGATTCA
TTATCGTGTGGCTGTAAATTATTACCGAAACAAAGTTTGGTTAATCAAGGGTAG