SecReT6
Protein ID: 523522855
SecReT6 ID816
T6SS typei4b
Gene symbol-
Locus tagBJAB07104_01471
StrainAcinetobacter baumannii BJAB07104
Repliconchromosome [GenBank: NC_021726] [Browse all T6SS(s) in this replicon]
Location [Strand]1548790..1549884 [+]
Producthypothetical protein
NoteTssA
UniProt IDS5DC04
KEGG IDabj:BJAB07104_01471
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-20, Aligned region: 55..114
Protein Sequence: 364 a.a.     [Download]
>gi|523522855|ref|YP_008208934.1| hypothetical protein BJAB07104_01471 [Acinetobacter baumannii BJAB07104]
MSIDISELLKPINDSLLCGEDYSFSNEFHEIKKARTQDDLLLDQGDWVAERKQADWDFVAKSVSTLLIEK
TKDIRLLTWVIEAWTHLNGFEGMVKGITLTHTMLNQYWQDIHPIIEDDDLDQRIGLLQGLINQLPMLLKK
VPLTNTAPYYNLLDYDNFLYHENIRRKQTEEYESQSGPSELEQFDQAIFNTSKTFQYSNYQEFNSVLTEW
NVLKQTLDHLMGLDSPSFAAIDSAFETIHSTLRKIYKAEAFGTGLAPSQEQAAVITTPSMENQVPVQIVS
DQPMFQPQAQTHLANREQAMKVLQEIADYFQANEPHSPVSYMLQKTIKWSQMPLHEWLAQVIKDEHPLQM
VQEMLGVQPKNEYE
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|523521389|ref|NC_021726.1|:1548790-1549884 Acinetobacter baumannii BJAB07104, complete genome
ATGAGTATTGATATTTCTGAACTACTTAAACCCATTAATGACAGCTTGCTTTGTGGTGAGGATTATTCAT
TTTCTAATGAATTTCACGAGATAAAGAAAGCCAGAACACAGGATGATCTATTATTAGATCAGGGGGATTG
GGTTGCTGAACGGAAGCAGGCAGATTGGGACTTTGTTGCGAAGAGTGTAAGCACTTTGCTCATTGAAAAA
ACCAAAGATATCCGTCTATTAACTTGGGTAATAGAAGCCTGGACTCATCTAAATGGTTTTGAAGGCATGG
TAAAGGGAATCACTTTAACTCATACCATGCTGAACCAATATTGGCAGGATATTCATCCGATTATTGAAGA
TGATGATTTGGATCAGCGTATTGGTTTATTACAAGGTCTTATTAATCAGTTGCCAATGCTGTTGAAGAAA
GTACCTTTAACCAATACAGCTCCTTATTATAACTTGCTTGATTACGATAATTTTCTATATCACGAAAATA
TACGCCGTAAGCAAACAGAAGAGTACGAGAGTCAGTCAGGTCCATCTGAATTAGAACAATTTGATCAAGC
GATCTTTAATACCTCTAAAACCTTTCAATACTCAAATTATCAAGAGTTTAATTCGGTTTTAACGGAGTGG
AATGTTTTAAAACAGACACTCGACCATTTAATGGGATTAGATTCACCGAGTTTTGCTGCAATTGATTCTG
CATTTGAAACAATACACAGCACTTTACGTAAAATTTACAAAGCAGAGGCTTTTGGTACTGGGCTTGCGCC
GAGCCAAGAACAGGCCGCTGTCATCACGACACCGTCTATGGAAAATCAAGTGCCTGTACAAATCGTATCA
GACCAGCCTATGTTTCAGCCACAAGCACAAACTCACTTGGCCAATCGCGAGCAAGCAATGAAAGTGCTGC
AAGAAATAGCTGATTATTTTCAAGCAAATGAGCCACATAGTCCTGTGAGCTATATGCTCCAAAAGACCAT
TAAATGGAGCCAAATGCCGCTGCATGAATGGTTAGCACAAGTGATTAAAGATGAGCATCCATTGCAAATG
GTTCAGGAAATGTTAGGTGTTCAACCTAAAAATGAATATGAATAA