SecReT6
Protein ID: 523522856
SecReT6 ID816
T6SS typei4b
Gene symbol-
Locus tagBJAB07104_01472
StrainAcinetobacter baumannii BJAB07104
Repliconchromosome [GenBank: NC_021726] [Browse all T6SS(s) in this replicon]
Location [Strand]1549901..1551265 [+]
Producthypothetical protein
NoteTssK
UniProt IDS5D8W5
KEGG IDabj:BJAB07104_01472
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-125, Aligned region: 19..451
Protein Sequence: 454 a.a.     [Download]
>gi|523522856|ref|YP_008208935.1| hypothetical protein BJAB07104_01472 [Acinetobacter baumannii BJAB07104]
MFKAEKVLWGEGLFLRPQHFQIQDTYHEQRLNHTVRAVVPFSYGVQKLSFDEAQLSTHILALESVEMIWQ
DGEIYQAPAYDLLPEPILLDELNLRGEMVIYLALPLLQANKQNLIDQNQSQKGRYQSHLVETHDLFTNAT
EADISLLRRRAVFKLLDAHSNPDHNLDGFLYLPIGKIKRQSSGAFEIDRKFIPPILHVDASETLVSNLKR
TLNVIKAKIKTIQTNNRENEQKLIEFRSGDIVSFWLVNALNTAHAGLSHFLQYPQIHPERLFFELLRLAG
SLLTFSTAYEVDQLPAYKHHNLQESFTQLDTILRDLLDTIISSRYISIALKEIRPSYWVGSLETDKITRD
TRLYIAVSSSVMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLIQVPTAIPVRSGVSYFEIELH
HELYQRMLDSETICIYVPAGFQDISIELIAVMNA
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|523521389|ref|NC_021726.1|:1549901-1551265 Acinetobacter baumannii BJAB07104, complete genome
ATGTTTAAAGCTGAAAAAGTCCTGTGGGGTGAAGGTTTATTTTTAAGACCTCAACATTTCCAGATTCAAG
ATACCTATCATGAACAACGTTTAAATCATACGGTTCGTGCTGTTGTTCCATTTTCCTATGGCGTTCAAAA
ACTTAGTTTTGATGAAGCACAGTTAAGTACGCATATTCTTGCACTTGAATCGGTAGAAATGATTTGGCAA
GATGGTGAAATATATCAAGCGCCTGCTTATGACTTATTACCTGAACCTATTTTGCTTGATGAGCTTAATT
TACGTGGTGAAATGGTCATCTATTTGGCATTACCATTATTACAAGCCAATAAACAAAATTTAATCGATCA
AAATCAATCACAAAAGGGGCGCTATCAATCACATTTGGTTGAGACCCATGATCTGTTCACAAACGCGACA
GAGGCTGATATCAGCTTATTACGTCGTCGAGCTGTGTTTAAATTATTAGATGCACATAGTAATCCTGATC
ATAATTTAGATGGTTTCCTGTATTTGCCAATAGGCAAAATTAAACGTCAGAGTTCAGGTGCTTTTGAAAT
TGACCGCAAATTTATTCCGCCCATTTTGCATGTCGATGCATCTGAGACCTTGGTTTCAAATTTAAAAAGA
ACCTTGAATGTTATTAAGGCAAAAATTAAAACGATTCAAACCAATAACCGAGAAAATGAGCAGAAATTAA
TTGAATTCCGTTCAGGTGATATCGTTTCGTTTTGGTTGGTAAATGCTTTAAATACTGCTCATGCTGGTCT
GAGCCATTTCTTGCAATATCCGCAAATTCATCCGGAACGATTATTCTTTGAATTGCTACGTTTAGCAGGT
TCATTATTAACCTTCTCGACAGCTTATGAAGTTGATCAGTTACCTGCATATAAACATCATAATTTGCAAG
AGAGTTTCACCCAGCTCGACACAATTTTACGTGATTTACTCGATACGATTATTTCGAGTCGTTACATCAG
TATTGCCCTTAAAGAAATTCGCCCTTCATATTGGGTGGGAAGTCTCGAAACCGATAAGATTACTCGAGAT
ACCAGACTTTATATTGCTGTATCAAGTAGCGTGATGCAGACCCATGAGTTGATTCAAATCGTTCCTCTAC
GTTTTAAAATCGGTAGTACTTTAGATGTTGAACAACGTGTTGTTGCAGCATTACCAGCAATTCCATTACA
CCACTTAATCCAAGTTCCAACTGCTATTCCAGTACGTTCGGGTGTGAGCTATTTTGAAATCGAACTGCAT
CATGAACTCTATCAACGTATGTTGGATTCAGAAACGATTTGTATTTATGTTCCGGCTGGATTCCAAGATA
TCAGTATTGAGCTGATTGCGGTCATGAACGCTTAA