SecReT6
Protein ID: 523530587
SecReT6 ID818
T6SS typei4b
Gene symbol-
Locus tagBJAB0715_01466
StrainAcinetobacter baumannii BJAB0715
Repliconchromosome [GenBank: NC_021733] [Browse all T6SS(s) in this replicon]
Location [Strand]1542497..1545127 [+]
Producthypothetical protein
NoteTssI
UniProt IDS5CL76
KEGG IDabab:BJAB0715_01466
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-53, Aligned region: 46..385
DUF2345 [PF10106], Evalue: 6.70E-46, Aligned region: 695..847
T6SS_Vgr [PF13296], Evalue: 3.50E-39, Aligned region: 44..66
T6SS_Vgr [PF13296], Evalue: 3.50E-39, Aligned region: 564..672
T6SS_Vgr [PF13296], Evalue: 3.50E-39, Aligned region: 715..755
Phage_base_V [PF04717], Evalue: 4.00E-18, Aligned region: 444..544
Sarcoglycan_1 [PF04790], Evalue: 0.00022, Aligned region: 706..759
Sarcoglycan_1 [PF04790], Evalue: 0.00022, Aligned region: 775..826
DUF3540 [PF12059], Evalue: 0.0054, Aligned region: 691..754
DUF3540 [PF12059], Evalue: 0.0054, Aligned region: 769..819
Protein Sequence: 876 a.a.     [Download]
>gi|523530587|ref|YP_008216614.1| hypothetical protein BJAB0715_01466 [Acinetobacter baumannii BJAB0715]
MMSHKIFQILDSLGLVAQNRVLHVQFSNASLNNQVFLQRIEGEHTLNQGSGAELLCLSTNAHIALKQFIG
CQVAVDQVTDTGQFFRTTGIITEASQGQSDGSLTIYNLTLKDPTALWHKRRNSRVFMNKSVRDISEILFK
EWQGKSPLFASSITLDTSGLTKDYDVRPFVMQSNESDYDFLTRLWRSEGINWLVDESQLFVADPNASIQP
QVLRLIDDNQNYQALERRSIRYQRSSATEQFDTITQVKAERHLQPTSVHVQRWQADALQQEEGSGSVQGT
QKHSEHYDNASLNLEDAWHVSPAWMQDLNGEDQATASGNSQIEQLNQHINAYHHLSSKQFTVAGNVRDAQ
VGYWFELNEHPELDQHDSADKEFLILSKHYYNQNNLPKELQQQLERLLPQGKLKAAQLDSQNPEQRHFAE
LNVVRRNIKAVPEYNPLEHRPAAHPQRARVVGLEGESIHVDQWGRIKVRFLFTRVDDHSHDGGAGSNDND
TDSAWVDVLTPWAGAGYGARFLPRVGEIVVIDFFDGNIDRPFVVGRIHEAERHPTQFDQKGQLPDTKKLS
GIRSEEVDGKGFNQLRFDDTTGQISAQLQSSHAASQLNLGNLSHPKDKAESDGRGEGFELRTDQWGAVRA
GSGLLVSTHKQDQAQGVHLDASEAKQQIEGGLNNAKALSEVAKNQQTDPLDMLENIQTFLEVLKQEDPKK
AAEFQSAVMLLASPKSIAVSSNEDIHLSANGQLTQSAGDSINMSTQKNIVNHASQKISLFAAQEGARLFA
GKGKVEIQAQGDGLDVIARKGVQITSTEDTVYITSPTEINLTANGSQVKLNGSGIFPVTGGKLEVKAGQH
LFMGGSSINPPALDLPDCSAKQTQAAQNGSAKVDLS
 
Nucleotide Sequence: 2631 bp     [Download]
>gi|523529121|ref|NC_021733.1|:1542497-1545127 Acinetobacter baumannii BJAB0715, complete genome
ATGATGTCCCATAAAATATTTCAAATTTTAGATAGTTTAGGATTGGTCGCACAGAATCGCGTTCTTCATG
TGCAATTTTCCAACGCATCATTAAACAATCAAGTTTTTTTACAACGTATTGAAGGCGAACATACGCTTAA
TCAGGGCAGCGGTGCTGAGTTATTGTGTCTGTCGACAAACGCCCATATTGCATTAAAACAGTTTATTGGC
TGTCAGGTTGCCGTCGATCAGGTCACCGATACAGGCCAGTTTTTTAGAACGACAGGTATTATTACCGAAG
CCAGCCAAGGGCAAAGCGACGGCTCACTCACTATTTATAATTTAACTTTAAAAGACCCAACTGCACTCTG
GCATAAGCGCCGTAATAGCCGCGTGTTTATGAATAAAAGCGTGCGCGATATTAGTGAAATTCTATTTAAG
GAATGGCAAGGCAAAAGTCCGTTATTTGCCTCAAGCATAACGCTTGATACATCTGGCTTAACTAAAGACT
ACGATGTGCGTCCATTTGTGATGCAGTCAAATGAAAGCGATTATGACTTTTTAACCCGTTTGTGGCGTAG
TGAAGGCATTAACTGGCTGGTCGATGAGTCACAGCTTTTTGTTGCTGACCCAAATGCTTCTATTCAGCCA
CAAGTCTTACGTTTAATTGACGATAACCAAAATTATCAGGCACTTGAACGCCGTAGCATCCGCTATCAAC
GCAGCAGTGCGACAGAACAGTTTGATACCATTACCCAAGTCAAAGCTGAGCGTCATTTACAACCAACCTC
GGTTCATGTGCAACGCTGGCAAGCCGATGCTTTGCAACAAGAAGAAGGTAGCGGCAGTGTACAAGGCACC
CAAAAGCACAGCGAACACTATGACAATGCAAGCCTGAACCTTGAAGATGCATGGCATGTTAGCCCAGCGT
GGATGCAGGATTTAAACGGGGAAGATCAAGCCACAGCTTCAGGCAATAGCCAGATTGAACAACTTAACCA
GCACATCAATGCTTACCATCACCTGAGTTCTAAACAGTTTACCGTTGCAGGCAATGTCCGTGATGCACAG
GTAGGTTACTGGTTTGAACTCAATGAACACCCAGAACTTGACCAACATGACAGTGCTGATAAAGAGTTCT
TAATCTTAAGCAAACACTACTATAACCAGAATAATTTACCGAAAGAATTACAACAGCAACTTGAGCGTTT
ATTACCACAAGGCAAACTCAAGGCAGCCCAACTCGACAGTCAAAACCCTGAGCAGCGCCACTTTGCTGAG
CTGAATGTCGTTCGTCGTAACATCAAAGCTGTGCCTGAATATAACCCGCTAGAGCACCGACCAGCCGCTC
ATCCACAGCGCGCTAGAGTGGTGGGTTTAGAGGGTGAAAGCATTCATGTCGATCAATGGGGACGTATTAA
GGTCCGTTTCCTGTTTACCCGAGTTGATGACCACAGTCATGATGGTGGAGCAGGAAGTAACGACAATGAC
ACTGACTCCGCTTGGGTCGATGTGCTGACCCCATGGGCGGGTGCAGGTTATGGCGCACGTTTCTTGCCAC
GTGTTGGTGAAATTGTTGTCATCGATTTCTTTGACGGGAACATTGACCGCCCGTTTGTGGTGGGGCGTAT
TCATGAAGCCGAGCGCCACCCGACCCAGTTTGACCAGAAAGGTCAGCTACCTGACACCAAGAAACTCAGC
GGCATTCGTTCAGAAGAAGTTGATGGCAAAGGCTTTAATCAGCTCCGTTTTGATGATACCACAGGCCAAA
TCAGTGCCCAGCTACAAAGTAGCCATGCAGCCAGCCAGCTAAACTTGGGTAACTTAAGCCATCCAAAAGA
CAAGGCAGAAAGTGATGGTCGTGGGGAAGGTTTTGAACTCAGAACTGACCAATGGGGAGCAGTCAGAGCA
GGCAGTGGTTTACTCGTTAGTACCCACAAACAGGATCAAGCCCAAGGTGTACACCTTGATGCAAGCGAGG
CCAAGCAACAAATCGAAGGCGGCCTCAACAATGCCAAGGCACTCAGTGAAGTTGCTAAAAATCAGCAAAC
TGACCCGTTAGATATGCTTGAGAATATTCAGACTTTCTTAGAAGTTCTCAAACAAGAAGATCCTAAAAAG
GCTGCTGAGTTTCAATCAGCAGTGATGCTGCTGGCATCACCAAAAAGTATTGCTGTAAGTAGTAATGAAG
ATATACACCTCAGTGCAAATGGTCAGCTCACTCAAAGTGCTGGAGATAGCATTAATATGAGTACGCAAAA
GAATATAGTGAATCATGCGAGCCAAAAGATTAGTCTCTTTGCTGCTCAGGAGGGTGCTCGACTTTTTGCT
GGGAAGGGCAAAGTAGAAATTCAAGCTCAAGGTGATGGCTTAGATGTCATTGCTCGAAAAGGTGTACAGA
TTACTTCAACCGAAGACACAGTTTATATTACTAGCCCAACTGAGATTAATCTGACAGCAAACGGATCTCA
AGTTAAGCTGAACGGTTCAGGTATTTTCCCTGTTACGGGCGGTAAGCTTGAGGTGAAAGCTGGGCAGCAC
TTGTTTATGGGAGGGTCATCAATAAATCCACCTGCTTTAGATTTACCAGACTGTTCGGCTAAGCAAACTC
AAGCTGCTCAAAATGGTTCGGCTAAGGTAGATTTATCATGA