SecReT6
Protein ID: 523530601
SecReT6 ID818
T6SS typei4b
Gene symbol-
Locus tagBJAB0715_01480
StrainAcinetobacter baumannii BJAB0715
Repliconchromosome [GenBank: NC_021733] [Browse all T6SS(s) in this replicon]
Location [Strand]1554808..1555311 [+]
Producthypothetical protein
NoteTssB
UniProt IDS5CR23
KEGG IDabab:BJAB0715_01480
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-58, Aligned region: 11..166
Protein Sequence: 167 a.a.     [Download]
>gi|523530601|ref|YP_008216628.1| hypothetical protein BJAB0715_01480 [Acinetobacter baumannii BJAB0715]
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDKKFINVDLDNI
DEVMESLSPRAAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPLKKLVEARERLTDLRNKISNS
ERLEDLLDEVLKNTDQIRKLSAEADHE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|523529121|ref|NC_021733.1|:1554808-1555311 Acinetobacter baumannii BJAB0715, complete genome
ATGGCTAAGAGAGAAAGCGTACAAAAGAAGCTTCAGCGAATTCGACCTCCACGTGTTCAGCTTACATATG
ATGTCGAAATTGGTGATGCGAAAGAAGCGAAAGAACTACCATTCGTTGTAGGTGTAATGGGTGATTTTTC
AGCTGCATCTGAGCTTGAACGTACAAAATTAAAAGATAAAAAATTCATTAATGTCGATTTAGATAATATT
GATGAAGTAATGGAATCTCTGTCTCCAAGAGCTGCTTTTCAAGTAGACAATACGTTGACAGAAGAAGGCG
GTAAAATGGCTGTTGATTTAACGTTTAAGTCAATGGAAGATTTTCGCCCGGAAAATGTTGTACAGCAAGT
TGATCCATTAAAGAAATTGGTTGAGGCGCGTGAGCGTTTAACCGATTTAAGAAACAAAATTTCAAATAGT
GAGCGTTTAGAAGATCTGCTTGATGAGGTTCTTAAAAATACTGACCAAATCCGTAAATTAAGTGCGGAGG
CCGATCATGAATAA