SecReT6
Protein ID: 523530602
SecReT6 ID818
T6SS typei4b
Gene symbol-
Locus tagBJAB0715_01481
StrainAcinetobacter baumannii BJAB0715
Repliconchromosome [GenBank: NC_021733] [Browse all T6SS(s) in this replicon]
Location [Strand]1555304..1556785 [+]
Producthypothetical protein
NoteTssC
UniProt IDS5CL93
KEGG IDabab:BJAB0715_01481
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.60E-192, Aligned region: 65..489
Protein Sequence: 493 a.a.     [Download]
>gi|523530602|ref|YP_008216629.1| hypothetical protein BJAB0715_01481 [Acinetobacter baumannii BJAB0715]
MNNTQSAAMPLVENEEVNLLDSIVEQSRIARNEEEHSRAKSLIGELAKEVMAGTITVSENMTLSIDKRIA
EIDALISKQLSQIMHNEQFQKIESTWRGLYYFCQETPSNPLIKIRMLNTTKKELVKDFQGATDFDQSTLF
KKIYEEEYGSFGGAPYSALIGDFEFDRTPSDMYLLEQISHVAAAAHAPFISAASPSILGLESFTDIDRPR
DVSKIFETAEYVQWRSFRDSEDSRYVALTLPHVLGRLPYHPKEGTATEGFNFIEDVSGENHNEYLWMNAA
YAFGTRLTNAFDMHGWCAAIRGVEGGGLVEGLPVHTFKTQDGEVVFKCPTEIAITDRREKELSDLGFIPL
VHCKNTDYAAFFGAQSTQKPKKYDNDTANANSALSSQIQYIMAVSRIAHYLKAMMRDKVGSFASAGNVEA
FLNEWLSQYVLLDDGASQEAKAQYPLREASVKVVEDPAQPGHYKSVVFLRPHFQLDELSVSLRLVTELPQ
SSN
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|523529121|ref|NC_021733.1|:1555304-1556785 Acinetobacter baumannii BJAB0715, complete genome
ATGAATAATACTCAATCAGCAGCAATGCCACTTGTTGAAAATGAAGAAGTTAATCTTTTAGATTCGATTG
TTGAACAAAGCCGTATTGCACGAAATGAAGAAGAACATTCTCGTGCTAAAAGCTTAATTGGTGAGCTTGC
TAAAGAAGTAATGGCAGGGACCATTACTGTTTCTGAAAATATGACTTTATCAATTGATAAGCGTATTGCA
GAAATTGATGCTCTGATTTCAAAGCAGTTAAGTCAGATCATGCACAATGAACAATTCCAAAAAATTGAGT
CAACTTGGCGTGGTCTTTATTACTTTTGTCAGGAAACGCCTTCAAATCCGCTCATTAAAATTCGTATGCT
CAATACGACTAAGAAAGAGTTGGTAAAAGATTTCCAAGGTGCTACAGACTTCGATCAAAGCACTTTATTT
AAGAAAATCTACGAAGAAGAATACGGTTCTTTTGGTGGTGCACCATACTCAGCATTAATTGGTGATTTTG
AGTTTGATCGTACTCCATCTGATATGTATTTGCTTGAGCAAATCTCTCATGTTGCAGCGGCAGCACATGC
ACCATTTATTTCAGCTGCTAGTCCGAGCATTTTAGGCCTTGAATCATTTACAGATATTGATCGTCCTAGA
GATGTTTCAAAAATCTTTGAAACCGCTGAATATGTTCAATGGCGTTCGTTCCGTGATAGTGAAGACTCAC
GTTATGTTGCATTGACTTTGCCTCATGTCTTGGGTCGTCTCCCATATCATCCAAAAGAAGGTACTGCGAC
AGAAGGCTTTAATTTTATTGAAGATGTTTCTGGTGAAAATCACAATGAATATTTGTGGATGAATGCAGCT
TATGCTTTTGGTACTCGCTTAACAAATGCATTTGATATGCATGGTTGGTGTGCTGCTATTCGCGGTGTTG
AAGGTGGTGGTTTGGTTGAAGGCTTGCCAGTACATACTTTTAAAACACAAGATGGCGAAGTGGTATTCAA
GTGTCCAACTGAAATTGCAATCACGGATCGCCGTGAAAAAGAGTTAAGCGATCTAGGCTTCATTCCGTTA
GTACATTGTAAAAATACAGATTACGCAGCTTTCTTTGGCGCGCAATCAACTCAAAAGCCTAAAAAATATG
ACAATGATACAGCCAATGCAAACTCGGCTTTATCAAGTCAGATTCAGTACATCATGGCTGTTTCACGTAT
TGCACATTACTTAAAAGCAATGATGCGAGATAAAGTGGGTAGCTTTGCTTCTGCTGGAAATGTTGAAGCA
TTCTTAAATGAGTGGTTGTCACAGTATGTCTTACTTGACGATGGTGCTTCTCAAGAAGCAAAAGCTCAAT
ACCCGTTACGTGAAGCATCTGTAAAAGTTGTAGAAGATCCTGCTCAACCAGGTCACTACAAATCTGTGGT
TTTCTTGCGACCACATTTCCAGCTGGATGAGTTGTCGGTTTCTTTACGACTTGTCACTGAGTTACCTCAG
TCCTCAAATTAA