SecReT6
Protein ID: 523530603
SecReT6 ID818
T6SS typei4b
Gene symbol-
Locus tagBJAB0715_01482
StrainAcinetobacter baumannii BJAB0715
Repliconchromosome [GenBank: NC_021733] [Browse all T6SS(s) in this replicon]
Location [Strand]1556835..1557338 [+]
ProductHemolysin-coregulated protein (uncharacterized)
NoteTssD
UniProt IDS5CXQ1
KEGG IDabab:BJAB0715_01482
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.30E-43, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|523530603|ref|YP_008216630.1| Hemolysin-coregulated protein (uncharacterized) [Acinetobacter baumannii BJAB0715]
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATS
PKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYN
QQDINGTAKGAVTKKWSLSNNTASYAA
 
Nucleotide Sequence: 504 bp     [Download]
>gi|523529121|ref|NC_021733.1|:1556835-1557338 Acinetobacter baumannii BJAB0715, complete genome
ATGAAAGATATATACGTTGAGTTTCGCGGTAAATATAAAGTTGATGGAGAATCTCGTGATTCTGAGCACA
AAGGTTGGTTAGAAGTTAACTCTTGGTCTCATAACATCCGTCAACCTAAATCTGCTACTTCAAGTAGTGT
AGGCGGCCACACTGCTGAACGTGTTGAACATTCAGACATGGTTTTCGTGAAAGACTTAGACGCAACTAGC
CCTAAATTATGGGAAGCTTGTTCAGCCGGTTATACATTTGATGAAGTACAAATCGATTTCTATCGTGCAA
ATGGCGATAAACGTATCAAGTACTTACAAATCAAATTGAAGCACGTTCTAGTTTCTAGTGTAACTCCAAC
TGTTAACGAAGAAGGCGTTCCTACAGAAGCATTCGGTTTGAAATATGCTGCTGTTGAGTGGACTTATAAC
CAACAAGATATTAACGGTACTGCTAAAGGTGCTGTTACTAAGAAATGGTCACTTTCTAATAATACAGCTT
CTTACGCAGCGTAA