SecReT6
Protein ID: 523530605
SecReT6 ID818
T6SS typei4b
Gene symbol-
Locus tagBJAB0715_01484
StrainAcinetobacter baumannii BJAB0715
Repliconchromosome [GenBank: NC_021733] [Browse all T6SS(s) in this replicon]
Location [Strand]1557911..1559722 [+]
Producthypothetical protein
NoteTssF
UniProt IDS5CME1
KEGG IDabab:BJAB0715_01484
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.70E-155, Aligned region: 5..603
Protein Sequence: 603 a.a.     [Download]
>gi|523530605|ref|YP_008216632.1| hypothetical protein BJAB0715_01484 [Acinetobacter baumannii BJAB0715]
MIEELLPFYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARIDKKLTDSYDV
FTRSLFEVMFPQYLRHFPACSVVSFEDINKIKQLTEPHLVPHHTVLKSRSFKGVQCEFNTTQDVKLLPIH
LSGLDFKTTPSAHMHLNQNATLSLKFEIFNNAHTCLTDEKLPIYLDAISNFPLQVLDSIFKKGTSFAVKY
GQTIVELSKNPFELIGFAEQESLLPLDQHTHHAYRLLMEYFCFPEKFSYLKLDLDFLKRIPQHVSELELL
IHFKLNLNDQAVVRNYSELNIANFKLFTTPVINLFEKYAEPQKIVHKQLEYPLVTDAHHPEFYQVYSILE
MNMVREKTNQEESYVPVLPFFAMSHYHNDTARFFYSVNYQKLQSNFVEMGYSIISKNLNPFSTRSDFIST
KLLCSNRDLPHEALGQSNNVLNLNDSSLARRAIVLKRPTKPYKFEQGQSEQWRVISHLSLNSLALMKGDA
VSHVKELLALYNLPQSKENYLIIESIKKLEFSLTHKLVDGKPFPMFVRGVKAELQIDSSVFRGHSLYIFS
QLLSRVFNLKVQINSFVDLVVKDYSSQQELYQCSQNVGGKTLL
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|523529121|ref|NC_021733.1|:1557911-1559722 Acinetobacter baumannii BJAB0715, complete genome
GTGATAGAAGAGCTTTTACCGTTTTATGAAAAACAATTACAAGAATTTGGTCAACAATCTCGGGAATTTG
CCCAAAAATATCCAAAAATTGCTCAGCGCTTATCTTTAAATCAAGAGCAAATTGATGACCCACATATTGA
ACGTCTGATTCAGGCTTTTTCGCTGATTGCTGCTCGAATCGATAAAAAACTAACAGACAGTTACGATGTT
TTTACTCGTTCTTTATTTGAGGTGATGTTCCCTCAATACTTACGACATTTTCCTGCGTGTTCAGTTGTTA
GTTTTGAGGATATTAATAAGATTAAACAGCTTACAGAACCTCATCTTGTACCTCATCATACGGTTTTGAA
ATCTCGTAGTTTCAAAGGGGTGCAGTGTGAGTTTAATACAACTCAAGATGTTAAATTACTACCTATTCAT
TTAAGTGGTTTAGATTTTAAAACTACACCTAGTGCGCATATGCACTTAAATCAAAATGCGACGTTGAGCC
TTAAATTTGAAATTTTTAATAATGCTCATACTTGTTTAACTGATGAGAAGCTTCCTATTTATTTGGATGC
TATCTCTAATTTTCCTCTACAGGTCCTTGATAGTATTTTCAAAAAAGGAACCAGTTTTGCGGTTAAATAT
GGACAAACAATTGTAGAATTGAGCAAGAATCCATTCGAATTGATTGGTTTTGCAGAACAAGAAAGTTTAT
TACCGCTTGATCAACATACCCATCATGCTTATCGTTTGTTGATGGAATACTTTTGTTTCCCGGAAAAGTT
TAGTTATCTTAAGCTCGATTTAGATTTTTTAAAGCGAATACCTCAGCATGTATCCGAACTTGAGCTTTTA
ATTCATTTCAAATTAAACTTAAATGATCAAGCCGTTGTCAGAAACTATTCTGAGCTAAATATTGCAAACT
TTAAATTATTTACTACCCCAGTAATTAATTTATTTGAAAAATATGCTGAACCCCAGAAGATAGTTCATAA
GCAATTAGAATATCCTTTAGTTACAGATGCACATCATCCTGAGTTTTATCAGGTATATTCAATACTTGAG
ATGAATATGGTGCGTGAAAAAACAAATCAGGAAGAAAGCTATGTTCCTGTTTTGCCGTTTTTTGCGATGA
GCCATTACCACAATGATACAGCTCGCTTTTTTTACTCAGTGAACTATCAAAAGTTACAGTCCAATTTCGT
TGAAATGGGCTATTCCATTATTTCTAAAAATTTAAATCCATTTTCAACGCGCTCAGATTTTATTAGCACC
AAATTATTATGTTCAAACCGTGATTTACCTCATGAAGCACTGGGGCAGTCTAATAACGTATTAAATTTAA
ATGATAGTAGCTTGGCGAGACGTGCCATTGTTTTAAAACGACCTACCAAGCCTTATAAGTTTGAACAAGG
CCAAAGTGAACAGTGGCGTGTGATCTCGCATCTTTCATTAAATAGCTTAGCGCTTATGAAAGGGGATGCT
GTTTCTCATGTTAAAGAGCTGCTGGCTTTATATAACTTACCGCAGTCAAAAGAAAACTATTTAATTATAG
AATCAATTAAAAAATTAGAATTTTCTCTTACCCATAAACTCGTAGATGGCAAACCATTTCCAATGTTTGT
AAGAGGAGTAAAAGCTGAATTACAAATTGATTCATCCGTATTTAGAGGGCATAGCTTATATATTTTTAGT
CAGTTATTAAGTCGTGTTTTTAATTTAAAGGTTCAAATTAATAGTTTTGTTGATTTGGTGGTTAAGGATT
ATTCATCTCAGCAGGAGTTATACCAATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAA