SecReT6
Protein ID: 523530606
SecReT6 ID818
T6SS typei4b
Gene symbol-
Locus tagBJAB0715_01485
StrainAcinetobacter baumannii BJAB0715
Repliconchromosome [GenBank: NC_021733] [Browse all T6SS(s) in this replicon]
Location [Strand]1559686..1560684 [+]
Producthypothetical protein
NoteTssG
UniProt IDS5CR27
KEGG IDabab:BJAB0715_01485
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.00E-63, Aligned region: 18..311
Protein Sequence: 332 a.a.     [Download]
>gi|523530606|ref|YP_008216633.1| hypothetical protein BJAB0715_01485 [Acinetobacter baumannii BJAB0715]
MQSERWWQDSSVTAELFQRPKSFEFIQATRLLRHMPANDAALSWSDHFKFETSFNLNFPATEIESLELVD
ERVHLTNLIVGLTGIQGALPYTYTNKIKQAPRQQRAETKEFLSLFNHKLTSQYVESSITYHLPVRYEIEN
KNDYLDILHALNGYVRSQHQQQDLDEYFAEFSGLMQGQNNTVHALKTMLSCIFKHEITIKEFVQESFKLA
GDQLTTLGGSQPSLLGINTFCGETIQQIDGKIEIQIGPLKRQQYLKFLPHQELSLKLKKIVETWCSPTLS
IDLRLILDESEIQPVRLTQGQESGLGQGAFLISRKPNTHNDETCYSLIGEQI
 
Nucleotide Sequence: 999 bp     [Download]
>gi|523529121|ref|NC_021733.1|:1559686-1560684 Acinetobacter baumannii BJAB0715, complete genome
ATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAACGGCTGAGTTGTTTCAACGCCCTAAGTCTTTTG
AGTTTATTCAAGCAACACGTTTATTGCGTCATATGCCTGCCAATGACGCAGCTTTGTCATGGTCTGACCA
TTTTAAATTTGAGACCTCATTTAACTTAAATTTTCCGGCCACTGAAATTGAAAGTTTAGAGTTAGTAGAT
GAGCGTGTTCATTTAACAAACCTGATCGTTGGTCTTACCGGTATACAGGGTGCATTACCTTATACATATA
CAAATAAAATTAAGCAGGCTCCAAGGCAACAACGCGCTGAAACGAAAGAGTTTTTAAGCTTGTTTAATCA
TAAGTTGACCAGTCAGTATGTAGAGTCAAGTATTACTTATCACTTGCCTGTGCGCTATGAAATTGAAAAT
AAAAATGATTATTTGGATATTCTCCATGCATTGAATGGCTATGTTCGCTCACAACATCAGCAACAAGACT
TGGATGAATATTTCGCTGAATTTTCAGGCCTAATGCAAGGGCAAAATAATACGGTTCATGCTTTAAAGAC
GATGTTGAGTTGTATTTTTAAGCATGAAATTACAATTAAAGAGTTTGTACAGGAATCGTTTAAGTTAGCG
GGTGATCAGTTAACCACTTTGGGTGGAAGTCAACCGAGCTTACTTGGTATTAACACATTTTGTGGGGAAA
CGATTCAACAAATTGATGGAAAAATTGAGATTCAAATAGGTCCGCTTAAGCGTCAGCAATATTTAAAATT
TTTACCTCATCAAGAGCTTAGCTTAAAGCTCAAAAAAATCGTAGAAACATGGTGCAGCCCAACTTTATCG
ATAGATTTAAGATTGATATTGGATGAGTCTGAAATACAACCTGTTCGCTTAACTCAAGGCCAAGAAAGTG
GCCTAGGGCAAGGCGCTTTTTTAATCTCTCGTAAGCCTAATACACATAACGATGAAACATGTTATAGCCT
TATAGGAGAGCAAATATGA