SecReT6
Protein ID: 523530612
SecReT6 ID818
T6SS typei4b
Gene symbol-
Locus tagBJAB0715_01491
StrainAcinetobacter baumannii BJAB0715
Repliconchromosome [GenBank: NC_021733] [Browse all T6SS(s) in this replicon]
Location [Strand]1568214..1570895 [+]
ProductATPases with chaperone activity, ATP-binding subunit
NoteTssH
UniProt IDS5CLA4
KEGG IDabab:BJAB0715_01491
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.10E-43, Aligned region: 229..307
AAA_2 [PF07724], Evalue: 1.10E-43, Aligned region: 606..774
AAA [PF00004], Evalue: 1.40E-23, Aligned region: 230..343
AAA [PF00004], Evalue: 1.40E-23, Aligned region: 611..729
AAA_5 [PF07728], Evalue: 5.80E-14, Aligned region: 230..252
AAA_5 [PF07728], Evalue: 5.80E-14, Aligned region: 610..731
ClpB_D2-small [PF10431], Evalue: 5.80E-13, Aligned region: 384..397
ClpB_D2-small [PF10431], Evalue: 5.80E-13, Aligned region: 780..850
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 10..73
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 207..252
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 274..309
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 477..516
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 605..654
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 676..704
AAA_22 [PF13401], Evalue: 6.50E-09, Aligned region: 229..323
AAA_22 [PF13401], Evalue: 6.50E-09, Aligned region: 459..503
AAA_22 [PF13401], Evalue: 6.50E-09, Aligned region: 607..637
Sigma54_activat [PF00158], Evalue: 8.80E-08, Aligned region: 227..248
Sigma54_activat [PF00158], Evalue: 8.80E-08, Aligned region: 607..717
AAA_19 [PF13245], Evalue: 1.10E-07, Aligned region: 230..250
AAA_19 [PF13245], Evalue: 1.10E-07, Aligned region: 606..632
AAA_14 [PF13173], Evalue: 4.50E-07, Aligned region: 230..333
AAA_14 [PF13173], Evalue: 4.50E-07, Aligned region: 608..693
AAA_17 [PF13207], Evalue: 1.10E-06, Aligned region: 230..277
AAA_17 [PF13207], Evalue: 1.10E-06, Aligned region: 466..495
AAA_17 [PF13207], Evalue: 1.10E-06, Aligned region: 609..647
IstB_IS21 [PF01695], Evalue: 1.50E-06, Aligned region: 224..290
IstB_IS21 [PF01695], Evalue: 1.50E-06, Aligned region: 610..630
AAA_25 [PF13481], Evalue: 2.10E-06, Aligned region: 230..293
AAA_25 [PF13481], Evalue: 2.10E-06, Aligned region: 285..326
AAA_25 [PF13481], Evalue: 2.10E-06, Aligned region: 372..386
AAA_25 [PF13481], Evalue: 2.10E-06, Aligned region: 606..637
AAA_25 [PF13481], Evalue: 2.10E-06, Aligned region: 833..865
NACHT [PF05729], Evalue: 4.10E-06, Aligned region: 230..328
NACHT [PF05729], Evalue: 4.10E-06, Aligned region: 610..649
AAA_18 [PF13238], Evalue: 6.10E-06, Aligned region: 230..260
AAA_18 [PF13238], Evalue: 6.10E-06, Aligned region: 478..541
AAA_18 [PF13238], Evalue: 6.10E-06, Aligned region: 611..640
Arch_ATPase [PF01637], Evalue: 9.70E-06, Aligned region: 63..104
Arch_ATPase [PF01637], Evalue: 9.70E-06, Aligned region: 209..243
Arch_ATPase [PF01637], Evalue: 9.70E-06, Aligned region: 282..380
Arch_ATPase [PF01637], Evalue: 9.70E-06, Aligned region: 471..491
Arch_ATPase [PF01637], Evalue: 9.70E-06, Aligned region: 606..656
Zeta_toxin [PF06414], Evalue: 1.90E-05, Aligned region: 230..250
Zeta_toxin [PF06414], Evalue: 1.90E-05, Aligned region: 605..650
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 229..248
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 300..310
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 574..632
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 679..705
AAA_29 [PF13555], Evalue: 0.00033, Aligned region: 222..246
AAA_29 [PF13555], Evalue: 0.00033, Aligned region: 605..634
AAA_29 [PF13555], Evalue: 0.00033, Aligned region: 714..734
T2SE [PF00437], Evalue: 0.00086, Aligned region: 215..249
T2SE [PF00437], Evalue: 0.00086, Aligned region: 424..458
T2SE [PF00437], Evalue: 0.00086, Aligned region: 582..679
RNA_helicase [PF00910], Evalue: 0.00094, Aligned region: 231..254
RNA_helicase [PF00910], Evalue: 0.00094, Aligned region: 611..632
AAA_28 [PF13521], Evalue: 0.0016, Aligned region: 230..267
AAA_28 [PF13521], Evalue: 0.0016, Aligned region: 610..633
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 225..250
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 589..633
AAA_33 [PF13671], Evalue: 0.0039, Aligned region: 231..302
AAA_33 [PF13671], Evalue: 0.0039, Aligned region: 609..631
TIP49 [PF06068], Evalue: 0.0042, Aligned region: 230..253
TIP49 [PF06068], Evalue: 0.0042, Aligned region: 278..310
TIP49 [PF06068], Evalue: 0.0042, Aligned region: 610..645
NTPase_1 [PF03266], Evalue: 0.0042, Aligned region: 230..250
NTPase_1 [PF03266], Evalue: 0.0042, Aligned region: 281..306
NTPase_1 [PF03266], Evalue: 0.0042, Aligned region: 610..631
Atg14 [PF10186], Evalue: 0.0052, Aligned region: 438..520
DUF2075 [PF09848], Evalue: 0.0062, Aligned region: 230..332
DUF2075 [PF09848], Evalue: 0.0062, Aligned region: 384..507
DUF2075 [PF09848], Evalue: 0.0062, Aligned region: 609..641
MobB [PF03205], Evalue: 0.0065, Aligned region: 231..264
MobB [PF03205], Evalue: 0.0065, Aligned region: 609..640
Clp_N [PF02861], Evalue: 0.0073, Aligned region: 32..74
Clp_N [PF02861], Evalue: 0.0073, Aligned region: 102..132
Protein Sequence: 893 a.a.     [Download]
>gi|523530612|ref|YP_008216639.1| ATPases with chaperone activity, ATP-binding subunit [Acinetobacter baumannii BJAB0715]
MMSSLKILITKLSTAARTALEKSANACVLQQNYEIEIEHLFLELLNQPLENDLKILLKKYKISADALADD
LKETISQLPKGNTRTPIFAKSIVRLFEQAWLLASAEQNPVIRSGHLLVALLTAPDLYQIATRASSLFDLF
PIDSMKHKFLEICEKSVEQQEESKTSSQADELEQAATPTAKTQKTPALDQYTINLTEKAKNGGIDPVIGR
EYEIRLMLDILMRRRQNNPILTGEPGVGKTAVVEGLALKIAQGLVPEALKNVHLHVLDMGLLQAGASVKG
EFENRLKQVIQEVQSSAHPIILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRTIAATTWAEYKQYF
EKDAALSRRFQVVKVEEPTEEVAVDMLRAMIPVMQNHFNLQIDDEAIVTAVHASHRYISGRQLPDKAVSV
LDTAAARVALTQNAQPVKLDQLKAQEHNLKLEQQILENEHRQIPIHHERLENLKNQLESLQSEIQETQEQ
WQKELELVRKIQELEAQSHSNESEAYDQINLIRKDLADIQGQQPLVFERVNSQIINEIISDWTGIPVGKM
VNDEIKQILTLEDKLGERVMGQDYALTQLVQGIKTSKAKLEDPNKPQGVFLLVGPSGVGKTETALALANE
LYGGEQHLITINMSEYQEAHTVSSLKGAPPGYVGYGQGGVLTEAVRRNPYSVVLLDEIEKAHSDVQELFY
QVFDKGTLEDGEGRVIDFKNTTILLTSNTGSSAIMQACLNQPVEEWPTAEDLIEHLKPSLYKQFKPAFLG
RMRVVPYFPLHDDLLVRIIKHKLGKITARIEKQYGTEVQYSDDLVELLLSRCTEVDSGARNVDNILNSTV
LPALATEILVALADQKLPKLIMIDAKDDEIQYLLDPVAKPAKKRTSKKLKSEV
 
Nucleotide Sequence: 2682 bp     [Download]
>gi|523529121|ref|NC_021733.1|:1568214-1570895 Acinetobacter baumannii BJAB0715, complete genome
ATGATGAGTAGTTTAAAAATTTTAATTACAAAACTTTCTACAGCTGCACGCACTGCTTTAGAAAAATCTG
CTAATGCTTGTGTTCTTCAGCAAAACTACGAAATTGAAATTGAACATTTATTTTTAGAGTTACTTAATCA
GCCTTTAGAAAACGATTTAAAAATTTTATTAAAAAAATATAAAATCTCAGCCGATGCTTTAGCAGATGAT
TTAAAAGAAACAATTTCTCAATTACCAAAAGGTAATACACGTACTCCAATTTTTGCTAAATCAATTGTTC
GTTTATTTGAACAAGCTTGGTTATTGGCTTCAGCAGAACAAAATCCTGTCATTCGTAGTGGTCATTTACT
GGTTGCATTATTAACTGCACCAGACCTCTATCAAATTGCAACGAGAGCTTCGAGTTTATTTGATCTTTTC
CCGATAGACTCAATGAAACATAAGTTTCTTGAAATTTGTGAAAAAAGTGTAGAACAACAAGAAGAATCAA
AAACATCTTCACAAGCAGATGAATTAGAACAAGCCGCGACTCCAACTGCAAAAACTCAAAAAACACCTGC
TTTAGATCAATATACAATTAATTTAACTGAAAAAGCGAAGAATGGTGGGATTGACCCTGTTATTGGGCGT
GAATATGAAATTCGTTTGATGCTCGATATTTTAATGCGTAGACGTCAGAACAACCCAATTTTAACTGGTG
AGCCAGGTGTAGGTAAAACAGCTGTAGTTGAAGGGTTGGCTTTAAAAATTGCTCAAGGTTTAGTTCCTGA
AGCATTAAAAAATGTACATTTGCACGTTTTAGATATGGGGCTTTTGCAAGCTGGGGCAAGTGTTAAAGGT
GAATTTGAAAACCGTTTAAAGCAAGTTATTCAAGAAGTCCAATCATCGGCTCATCCTATTATTTTATTTA
TTGATGAAGCGCATACGCTTATTGGAGCAGGTGGCCAAGCGGGGCAAAACGATGCTGCCAATCTTTTAAA
ACCTGCACTTGCTCGTGGCGAGTTACGTACTATTGCTGCAACAACATGGGCAGAATATAAACAGTATTTT
GAGAAAGATGCTGCATTAAGCCGCCGTTTTCAGGTGGTAAAGGTTGAAGAACCGACCGAAGAAGTTGCTG
TAGATATGTTACGTGCAATGATTCCCGTAATGCAAAATCACTTTAATTTACAAATTGATGATGAAGCAAT
TGTAACGGCTGTACATGCCTCTCACCGCTATATTAGTGGTCGTCAACTCCCAGACAAAGCAGTAAGTGTT
CTTGATACTGCAGCAGCGCGTGTAGCTTTGACCCAAAATGCACAACCAGTCAAACTTGATCAATTGAAAG
CACAAGAACATAACTTAAAGCTTGAGCAACAAATTTTGGAAAATGAACACCGTCAAATTCCAATACATCA
TGAAAGATTAGAAAATCTGAAAAACCAACTAGAGTCATTACAAAGTGAGATCCAAGAGACTCAGGAACAA
TGGCAAAAAGAATTAGAGCTAGTTCGTAAAATTCAGGAATTAGAAGCGCAGAGCCATTCTAATGAGTCTG
AAGCCTACGATCAGATTAATTTAATACGCAAAGACCTTGCTGATATTCAGGGACAACAGCCGTTAGTTTT
TGAGCGAGTAAACTCTCAGATCATCAATGAAATTATTTCTGATTGGACAGGTATTCCTGTTGGGAAAATG
GTCAATGATGAAATTAAGCAGATTTTAACGCTTGAAGATAAATTAGGTGAGCGTGTAATGGGGCAAGATT
ATGCACTTACACAATTAGTTCAAGGGATTAAAACTTCAAAAGCTAAATTAGAAGATCCAAATAAACCTCA
AGGGGTGTTCCTTTTAGTCGGGCCTAGTGGGGTTGGTAAAACTGAAACTGCTTTAGCCTTGGCTAATGAG
TTATATGGCGGTGAACAGCATTTAATCACGATTAATATGTCTGAGTATCAAGAAGCACATACTGTCTCTT
CGCTTAAAGGTGCACCTCCAGGCTATGTTGGCTATGGTCAGGGTGGGGTTTTAACTGAAGCTGTACGCCG
TAATCCTTATAGTGTTGTGTTACTCGACGAAATTGAAAAAGCACATAGCGATGTTCAGGAGTTGTTCTAT
CAAGTATTTGATAAAGGTACTTTAGAGGATGGTGAAGGGCGCGTTATTGATTTTAAAAACACGACAATCT
TATTAACTTCAAATACGGGCTCGAGTGCAATTATGCAGGCATGTTTAAATCAGCCTGTAGAAGAATGGCC
TACCGCAGAAGATTTAATCGAACATTTAAAGCCGAGTTTATATAAACAGTTTAAGCCAGCCTTTTTAGGG
CGTATGAGAGTTGTGCCATATTTCCCATTGCATGATGATTTATTGGTTCGAATTATTAAACATAAATTGG
GCAAAATTACTGCTCGAATTGAAAAACAATATGGAACGGAAGTTCAATATTCAGATGACTTGGTTGAATT
GCTACTCAGCCGTTGTACTGAAGTGGATAGTGGCGCCCGTAATGTTGATAACATCTTAAATTCTACAGTT
TTACCTGCTTTGGCAACTGAAATTTTAGTGGCGTTAGCAGATCAAAAATTGCCAAAATTGATCATGATTG
ATGCAAAAGATGACGAGATCCAATATTTACTAGATCCTGTGGCGAAGCCTGCTAAAAAACGGACTAGTAA
AAAGTTGAAATCAGAAGTTTAA