SecReT6
Protein ID: 523530615
SecReT6 ID818
T6SS typei4b
Gene symbol-
Locus tagBJAB0715_01494
StrainAcinetobacter baumannii BJAB0715
Repliconchromosome [GenBank: NC_021733] [Browse all T6SS(s) in this replicon]
Location [Strand]1573412..1574218 [+]
Producthypothetical protein
NoteTssL
UniProt IDS5CMF1
KEGG IDabab:BJAB0715_01494
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.90E-53, Aligned region: 34..239
Protein Sequence: 268 a.a.     [Download]
>gi|523530615|ref|YP_008216642.1| hypothetical protein BJAB0715_01494 [Acinetobacter baumannii BJAB0715]
MSQSTGAPSLFDDGQIGTGGNNNSQSQVKLQAINLIDLLHDGFYLIFLIRNQYVPADPQRFREKILDLLN
RFEQQAKKLQFSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNSWLISPLQLSLFGSQLAGYQFFEILE
QLRSRGKERLAALEVFHYCLLLGFQGKYRIESIESLNHLVARVGDEIDYLKGKKVAFSPFSAIPDQIRNI
IHRELPFFWILIFLLIFALLTFAGLRFMLNNQNDKALSNYQNVISAPQEQAHITIYLP
 
Nucleotide Sequence: 807 bp     [Download]
>gi|523529121|ref|NC_021733.1|:1573412-1574218 Acinetobacter baumannii BJAB0715, complete genome
ATGTCACAATCTACAGGTGCTCCTTCTTTATTTGACGATGGGCAAATTGGGACAGGGGGGAATAATAATA
GCCAGTCCCAAGTAAAGTTACAGGCAATTAATCTGATTGATTTATTGCATGATGGTTTTTACTTAATCTT
TTTAATTCGAAATCAGTATGTGCCAGCTGATCCACAGCGCTTTCGTGAAAAAATTCTAGATTTGCTTAAT
CGATTTGAGCAACAAGCGAAAAAGTTACAATTTTCAGCTGATGATATTCATGATGCTAAATATGCGTTTT
GTGCGCTAATTGATGAAACGATCGTAACCCAGCAAGACCCAAGCTATTTTAATTTACAAAATTCTTGGTT
AATTAGCCCATTACAGTTAAGTCTGTTTGGTTCTCAGTTAGCGGGTTATCAATTCTTCGAAATTTTAGAG
CAACTACGTAGTCGTGGAAAAGAGCGATTAGCTGCTCTTGAAGTCTTCCATTACTGCTTATTATTAGGTT
TTCAGGGTAAATACCGAATTGAGTCAATTGAAAGCCTTAACCATTTGGTGGCACGAGTAGGCGATGAAAT
TGATTATCTGAAAGGGAAAAAAGTGGCTTTTTCGCCATTCTCGGCAATTCCTGATCAGATACGAAATATT
ATCCATCGTGAGCTACCTTTTTTCTGGATTTTGATTTTCTTATTGATTTTTGCATTACTTACCTTTGCAG
GTTTAAGATTTATGCTTAACAATCAAAATGATAAAGCATTATCTAATTATCAAAATGTGATTTCTGCCCC
ACAAGAGCAGGCACATATTACAATTTACTTACCTTGA