SecReT6
Protein ID: 525711916
SecReT6 ID819
T6SS typei4b
Gene symbolvgrG
Locus tagF504_4450
StrainRalstonia solanacearum FQY_4
Repliconmegaplasmid [GenBank: NC_021745] [Browse all T6SS(s) in this replicon]
Location [Strand]1235965..1238985 [-]
ProductVgrG protein
NoteTssI
UniProt IDM4V2S4
KEGG IDrse:F504_4450
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.00E-56, Aligned region: 37..354
Phage_GPD [PF05954], Evalue: 8.00E-56, Aligned region: 731..763
DUF2345 [PF10106], Evalue: 1.90E-39, Aligned region: 768..929
T6SS_Vgr [PF13296], Evalue: 3.20E-34, Aligned region: 614..724
T6SS_Vgr [PF13296], Evalue: 3.20E-34, Aligned region: 887..909
T6SS_Vgr [PF13296], Evalue: 3.20E-34, Aligned region: 964..990
Phage_base_V [PF04717], Evalue: 9.20E-21, Aligned region: 450..549
Protein Sequence: 1006 a.a.     [Download]
>gi|525711916|ref|YP_008238179.1| VgrG protein [Ralstonia solanacearum FQY_4]
MDVTTLLQNLFAPAHRLYALEGEGPIAELAVEAWLGREALSELFEWRVVAASANARIALESFIGQRVTLV
TTLADGTQARRTGLIRQAEQLGADGSLARYRLTVVPWFWLATQQRHSQVFQNRPLADILEQMLSPYAPYA
AWRFAAGAEDRMAAFGTRTHIAQFRETDYRFVTRLLAEAGLGFTTVEDEQAPSGHALLIFADSSRLAEDT
ASAAEGGIRYHRAHSQEECDAIQALICHSRTAVGGVAVAAWDAQAKRAFRAHVPSRFCGIAGSPDAYLSI
SPSLAPDTANAQRIAEQVMESVEARARLFIGRGSVRTLRSGTRLKIVDCPHLPKDVDGPYPLLIDLVEHC
GINNLTADTQATLARKLGGLDVALTFDTPPSPPESGPGPFGFMAPHEVIERFTPTADLLTAARAHGYAGQ
FRASDARRPWRPVVSHPDTGRLYAEPTARGVQSAIVVGPNGETEASGDAEHHTTPRGQVRVRFPWQQGER
PDDRSTGWLLVAQRQAGAGMGWQWLPRIGQEVLVKFQEDDIDQPVVIGALYNGQGEAGIAPTPGGQVAKG
VRQEADPETLYRLGSDSAASAQGNLAAGHSPAWHGLGTEAEGHRNAAALSGFKSAEHGGRGANLLVFDDS
DGQLRTQLATTQAHSQLNLGHLIHQQDNRRGSFRGQGFELRTDGYGAVRGQAGVLLTTYRDATSGKAVPT
GDNAAGIALIRQAKQLTASLSQGATTHQTAALSTAKDDSAPLAKQEKAASGMVDGKALDAAQQDAAAGNT
ATQGKVPHQSEATVQLAGRAGLVAIAGQDLQFANGESVVLASGQDTNVAVGKQARIHAGQGIGVAAGLSK
AGDDDIGLQLTAGQDNLDVQAQHDALGLLSKDDLKLVSANLHVDFAAAKRIRLATAAGASITLEGGNIIV
ETPGRITYKAAQRSFAGPTHASRDMNTWSHSAFDDRYVLRDQVTHEPLRNTQVELRRGDGAVLKLVTDGE
GRLPVQKGISMERVQLRVLGKLSGKT
 
Nucleotide Sequence: 3021 bp     [Download]
>gi|525710956|ref|NC_021745.1|:c1238985-1235965 Ralstonia solanacearum FQY_4 megaplasmid, partial sequence
ATGGACGTAACGACCCTTCTCCAGAACCTCTTCGCTCCCGCGCACCGCCTGTACGCGCTGGAAGGCGAAG
GCCCGATCGCGGAACTGGCGGTGGAGGCATGGCTCGGCCGCGAGGCCTTGTCCGAGCTGTTCGAATGGCG
GGTGGTGGCCGCCAGCGCCAATGCGCGCATCGCGCTCGAATCGTTCATCGGCCAGCGCGTGACGCTGGTC
ACCACGCTGGCCGACGGCACGCAGGCCCGGCGCACCGGCCTGATCCGGCAGGCCGAGCAGCTCGGCGCCG
ATGGCAGCCTGGCGCGCTATCGCCTGACCGTGGTGCCGTGGTTCTGGCTCGCCACCCAACAGCGGCACAG
CCAGGTGTTCCAGAACCGGCCGCTGGCGGACATCCTCGAACAGATGCTGTCGCCGTATGCGCCCTATGCC
GCATGGCGCTTCGCCGCTGGCGCGGAAGACCGCATGGCGGCGTTCGGCACGCGCACGCACATCGCCCAGT
TCCGAGAGACCGACTACCGCTTCGTCACGCGCCTGCTGGCCGAGGCGGGTCTGGGCTTCACCACCGTCGA
GGATGAGCAGGCGCCCAGCGGCCACGCGCTGCTGATCTTTGCCGACAGCAGCCGGCTGGCCGAGGACACG
GCATCCGCTGCCGAGGGTGGCATCCGCTACCACCGCGCGCACAGCCAGGAAGAGTGCGACGCGATCCAGG
CGTTGATCTGCCATAGCCGCACAGCGGTCGGCGGAGTGGCGGTGGCGGCCTGGGATGCGCAGGCCAAGCG
GGCCTTCCGCGCGCACGTTCCCTCTCGGTTTTGCGGTATCGCGGGCAGCCCGGATGCCTATCTGTCGATC
AGCCCGTCGCTGGCGCCGGATACGGCCAACGCGCAGCGCATCGCCGAGCAGGTGATGGAGAGCGTCGAAG
CGCGCGCTCGCCTGTTCATCGGACGCGGCTCGGTGCGCACGCTGCGCAGCGGCACGCGACTGAAGATCGT
GGACTGCCCGCACCTGCCGAAGGACGTGGACGGCCCGTATCCGTTGCTGATCGACCTGGTGGAGCACTGC
GGCATCAACAACCTGACCGCCGATACGCAGGCAACATTGGCCCGGAAGCTGGGCGGGCTCGACGTCGCAC
TGACCTTCGACACGCCGCCCAGCCCACCCGAATCCGGCCCGGGCCCGTTCGGTTTCATGGCGCCACACGA
GGTCATCGAACGCTTCACGCCGACGGCGGACCTGCTCACCGCTGCGCGCGCCCACGGCTACGCCGGCCAA
TTCCGCGCGAGCGACGCACGCCGCCCGTGGCGACCGGTCGTGTCACACCCCGACACCGGCCGCCTGTACG
CCGAGCCCACCGCCAGGGGCGTGCAGAGCGCCATCGTGGTCGGCCCGAACGGCGAGACCGAGGCCAGTGG
CGATGCGGAGCACCACACCACTCCACGGGGCCAGGTCCGTGTCCGCTTCCCGTGGCAGCAGGGCGAACGT
CCGGATGACCGCAGCACCGGCTGGCTGCTGGTCGCGCAGCGGCAGGCTGGGGCCGGCATGGGCTGGCAGT
GGCTGCCGCGCATCGGCCAGGAGGTGCTGGTCAAGTTCCAGGAAGACGACATCGACCAGCCGGTGGTGAT
CGGCGCGCTCTACAACGGCCAGGGCGAAGCGGGTATCGCGCCGACCCCTGGCGGGCAGGTCGCCAAGGGT
GTCAGGCAGGAGGCCGACCCGGAGACCCTCTACCGTTTGGGCAGCGACAGCGCCGCCAGCGCGCAGGGCA
ACCTCGCCGCCGGCCACAGCCCCGCATGGCACGGCCTGGGCACCGAGGCCGAAGGCCACCGCAACGCCGC
CGCCCTCAGCGGCTTCAAGAGCGCCGAGCATGGCGGGCGCGGCGCCAACCTGCTCGTCTTCGACGACAGC
GACGGGCAGTTGCGTACGCAGTTGGCCACCACGCAGGCCCACAGCCAACTGAACCTGGGCCACCTGATCC
ACCAGCAGGACAACCGGCGCGGCAGCTTCCGGGGCCAGGGCTTCGAGCTGCGCACCGATGGCTATGGCGC
GGTGCGCGGCCAGGCCGGTGTGCTGCTGACCACCTACCGCGATGCCACGAGCGGCAAGGCTGTGCCGACC
GGCGACAACGCCGCCGGCATCGCGCTGATCCGGCAGGCCAAACAGCTCACCGCATCGTTGAGCCAGGGCG
CCACCACGCATCAGACGGCCGCGCTGTCCACCGCCAAGGACGACAGTGCGCCGCTCGCCAAGCAAGAGAA
GGCCGCCTCCGGCATGGTGGACGGCAAAGCGCTCGACGCCGCCCAGCAGGATGCGGCCGCAGGCAACACC
GCCACGCAAGGCAAGGTGCCGCATCAAAGCGAAGCGACGGTGCAGCTGGCCGGCCGCGCGGGCCTGGTGG
CGATCGCCGGGCAGGATCTGCAATTCGCCAACGGCGAGAGCGTTGTGCTGGCCAGCGGCCAGGACACCAA
CGTCGCGGTGGGCAAGCAGGCGCGCATCCACGCGGGGCAGGGCATCGGCGTGGCGGCGGGGCTGTCGAAG
GCGGGGGACGACGACATCGGGCTGCAACTGACAGCGGGGCAGGACAACCTCGACGTGCAGGCGCAGCATG
ACGCGCTCGGGCTGCTGTCCAAGGACGACCTGAAGCTGGTGTCGGCGAATCTGCATGTGGACTTCGCGGC
GGCCAAGCGGATCCGGCTGGCGACGGCGGCGGGGGCGTCGATCACGCTGGAGGGCGGGAACATCATCGTC
GAGACGCCGGGGCGGATTACGTACAAGGCGGCGCAGCGCAGCTTTGCGGGGCCCACGCACGCGTCGCGCG
ATATGAACACGTGGTCGCACAGTGCGTTTGACGATCGATATGTTTTGCGCGACCAGGTCACGCACGAGCC
GCTGCGGAATACGCAGGTCGAGTTGCGGCGTGGTGACGGTGCGGTACTCAAGCTGGTCACCGATGGAGAG
GGCCGCCTCCCTGTGCAGAAAGGTATTTCCATGGAGCGCGTGCAACTGCGCGTGCTGGGAAAGCTCTCCG
GCAAAACCTAA