SecReT6
Protein ID: 525711925
SecReT6 ID819
T6SS typei4b
Gene symbolimpA
Locus tagF504_4459
StrainRalstonia solanacearum FQY_4
Repliconmegaplasmid [GenBank: NC_021745] [Browse all T6SS(s) in this replicon]
Location [Strand]1249737..1250750 [-]
ProductUncharacterized protein ImpA
NoteTssA
UniProt IDM4UL67
KEGG IDrse:F504_4459
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-26, Aligned region: 34..95
ImpA-rel_N [PF06812], Evalue: 1.30E-26, Aligned region: 209..227
Protein Sequence: 337 a.a.     [Download]
>gi|525711925|ref|YP_008238188.1| Uncharacterized protein ImpA [Ralstonia solanacearum FQY_4]
MLFSTEFDTIQEARRFDDPSLDQGDWVTEIKEADWRAVVSESTALLQKRTKDLRLAAWLTEALSKERGFA
GLREGYELIAGLCEQYWEHLFPLPEPDDPEARTGSMAWLAGRSSQLIREVPLVEAGNGGFNYVDWEVATN
LIEAIRRDPDQADELSRGKVTQDQFEAARRASSSAFYTALYNDVVGCGAALLRLESVLDGRAGDHAPSFR
AAREALQAVRALVERFGGKTETKPSAVEPKATTAPQQTAQPVAEAVPDTGVGPIRTRAQALNQLREVAEF
FRQTEPHSPVAYLAARAAKWGDMPLHAWLRAVVKDDATLSQIEELLGLGDSPADDAS
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|525710956|ref|NC_021745.1|:c1250750-1249737 Ralstonia solanacearum FQY_4 megaplasmid, partial sequence
ATGCTCTTCTCCACCGAATTCGACACCATCCAGGAAGCGCGGCGCTTCGACGACCCCTCGCTCGATCAGG
GCGACTGGGTGACCGAGATCAAGGAGGCGGACTGGCGCGCCGTCGTCTCGGAAAGCACGGCGTTGCTGCA
GAAGCGCACCAAGGACCTGCGCCTGGCCGCGTGGCTGACCGAGGCGCTGTCCAAGGAGCGCGGCTTCGCC
GGCCTGCGCGAGGGCTACGAGCTGATCGCGGGGCTGTGCGAGCAGTATTGGGAGCACCTCTTCCCGCTGC
CCGAGCCGGATGATCCCGAGGCGCGCACCGGCAGCATGGCGTGGCTGGCGGGGCGCTCCAGCCAGCTGAT
CCGCGAGGTGCCGCTGGTGGAGGCGGGCAACGGCGGCTTCAACTATGTCGACTGGGAGGTCGCCACCAAC
CTGATCGAGGCGATCCGGCGCGATCCGGACCAGGCGGATGAGCTGTCGCGCGGCAAGGTCACGCAGGATC
AGTTCGAGGCGGCGCGCCGCGCGTCGTCTTCGGCGTTCTACACGGCGCTGTACAACGACGTGGTGGGTTG
CGGCGCGGCGCTGCTGCGGCTGGAATCCGTGCTGGACGGGCGCGCCGGGGATCATGCGCCGAGCTTCCGC
GCCGCGCGCGAGGCCTTGCAGGCAGTCCGCGCCCTGGTCGAGCGTTTCGGCGGCAAGACGGAAACCAAGC
CCAGCGCGGTCGAGCCCAAGGCCACCACCGCGCCGCAGCAGACCGCCCAGCCCGTCGCCGAGGCCGTGCC
CGATACCGGGGTCGGCCCGATCCGCACGCGCGCCCAGGCGCTGAACCAGCTGCGCGAGGTGGCCGAGTTC
TTCCGCCAGACCGAGCCGCACAGCCCGGTGGCCTACCTCGCCGCGCGCGCGGCCAAGTGGGGCGACATGC
CGCTGCACGCCTGGCTGCGCGCGGTGGTCAAGGACGATGCGACGCTGTCGCAGATCGAAGAACTGCTGGG
GTTGGGCGATTCGCCGGCGGATGACGCGAGCTGA