SecReT6
Protein ID: 525711936
SecReT6 ID819
T6SS typei4b
Gene symbolvgrG
Locus tagF504_4471
StrainRalstonia solanacearum FQY_4
Repliconmegaplasmid [GenBank: NC_021745] [Browse all T6SS(s) in this replicon]
Location [Strand]1264057..1266813 [-]
ProductVgrG protein
NoteTssI
UniProt IDM4V2T9
KEGG IDrse:F504_4471
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.80E-70, Aligned region: 42..362
DUF2345 [PF10106], Evalue: 2.60E-39, Aligned region: 542..583
DUF2345 [PF10106], Evalue: 2.60E-39, Aligned region: 626..680
DUF2345 [PF10106], Evalue: 2.60E-39, Aligned region: 724..885
T6SS_Vgr [PF13296], Evalue: 2.70E-24, Aligned region: 585..689
T6SS_Vgr [PF13296], Evalue: 2.70E-24, Aligned region: 772..772
Phage_base_V [PF04717], Evalue: 3.60E-19, Aligned region: 430..532
Protein Sequence: 918 a.a.     [Download]
>gi|525711936|ref|YP_008238200.1| VgrG protein [Ralstonia solanacearum FQY_4]
MVSPTELANLLRAAFTRANRLLRLDTPLGPNALLPERLDAAEHLDDGGFRLELTALSDDADLDPARLLGQ
PVRLDLLTQQSRGALRPFHGHVTRFEQLGANGGLVRYRLVIEPWLAFLRHRRDSFLFQDQSVIEVIDSLF
GDYNGQGRLAPAWRWSLRDASVYTRRSVITQYEESDFDFVTRLLAEEGLFYFFEHEAVEGDALGVHRMVI
ADANDAFTDNAQAAIRFGRADATANEDVIDRWQGVRRWQTNAVSIASWDYRANTQRSAQLGAQQRRDGIP
QLTLQDTDYPGQYWFEDSAQAQRSVRLVMEALELRDKQFDGEGSVRTLALGTRFQLVDHYEHGDDGEARF
AVLSVLHRARNNFNERFGQVLTQALGALSGADAQDAAGNAGTDATFYRNHFTVVHDTVPYRPQQRDAQGR
ALHPRPTVEGSQTALVVGTGGPVHTDRDHRIKVQFHWQRGARSASRQPHPAGDDNARAEAGLGCWVRVAA
PVAGPNWGGVALPRVGQEVLVEFVQGDIDRPVVVGAAYNGSGQRDAQYNQNQAGAAGATGNAPAWFAGDS
KSQGAYAHNAVLSGIKTQALAGSQTGASGYSQLVFDDTECQGRTQLSTTQAATALTLGHQKEQIDSARQA
DLGHGAALATNDSGSVRAGAGLLLTAHAADTGAALLDSEGAASQIEALSELAESLADVARKQQAGLPEEP
AAQDLPALKQLRHTTEVLRHAESAGKGASAIAYSEPHLQVSAPKGIAATTPADAVLVAGTQIALAAKQDA
NLAAGGNLAMAVADGLTLFAHGKAVGQSSDAARGIAMHAASGKVGLSALKGESRLVAEKAVTVASTQGNV
TAEGKARVLVNAAGAQIRVTNGTIELHAPGKTIFKGAGHVFVGPGGAAADNTLAQGNLKGCGIQEGNAAT
SGAGSVSR
 
Nucleotide Sequence: 2757 bp     [Download]
>gi|525710956|ref|NC_021745.1|:c1266813-1264057 Ralstonia solanacearum FQY_4 megaplasmid, partial sequence
ATGGTCTCACCGACCGAGCTGGCCAACCTGCTGCGGGCGGCCTTCACGCGGGCCAATCGGCTGCTGCGCC
TGGACACGCCGCTCGGGCCGAACGCGCTGCTGCCCGAGCGGTTGGACGCCGCCGAGCATCTCGACGATGG
CGGCTTCCGGCTGGAGCTGACCGCGCTGTCGGATGACGCCGATCTCGATCCGGCGCGCCTGCTGGGGCAG
CCCGTCCGGCTCGACCTGCTGACCCAGCAGAGCCGCGGCGCGCTGCGGCCGTTCCATGGCCACGTCACGC
GGTTCGAGCAGTTGGGCGCCAACGGCGGCCTGGTGCGCTACCGGCTGGTGATCGAACCCTGGCTGGCCTT
CCTGCGCCACCGGCGCGACAGCTTCCTGTTCCAGGACCAGTCGGTGATCGAAGTGATCGACAGCCTGTTC
GGCGACTACAACGGCCAGGGCCGCCTGGCGCCGGCGTGGCGCTGGTCGCTGCGCGATGCCTCGGTGTACA
CGCGCCGCAGCGTCATCACGCAATACGAAGAAAGCGATTTCGACTTCGTCACCCGCCTGCTGGCCGAGGA
AGGGCTGTTCTACTTCTTCGAGCACGAGGCGGTCGAGGGCGATGCGCTGGGCGTGCACCGCATGGTGATC
GCCGATGCCAACGATGCCTTCACCGACAACGCGCAGGCCGCGATCCGCTTCGGCCGCGCCGATGCCACCG
CCAATGAAGACGTGATCGACCGCTGGCAGGGCGTGCGGCGCTGGCAGACCAACGCCGTGTCGATCGCCAG
TTGGGACTACCGCGCCAACACCCAGCGCAGCGCCCAGCTCGGCGCGCAGCAGCGGCGCGATGGCATCCCG
CAACTGACGCTGCAGGACACCGACTACCCCGGGCAGTACTGGTTCGAAGACAGCGCCCAGGCCCAGCGCA
GCGTGCGCCTGGTGATGGAAGCGCTGGAGCTGCGCGACAAGCAGTTCGACGGCGAAGGCAGCGTGCGCAC
GCTGGCGCTGGGCACGCGCTTCCAACTGGTTGATCATTATGAGCACGGCGACGACGGCGAGGCGCGCTTC
GCCGTGCTGTCCGTCCTGCACCGGGCACGCAACAACTTCAACGAGCGCTTTGGCCAGGTGCTGACGCAGG
CGCTGGGCGCGCTGTCCGGCGCCGACGCGCAAGACGCCGCGGGCAACGCGGGCACCGACGCCACGTTTTA
CCGTAACCACTTCACGGTCGTGCACGATACCGTGCCGTACCGCCCGCAGCAGCGCGATGCGCAGGGCCGT
GCGCTGCATCCGCGTCCGACGGTCGAGGGCAGCCAGACCGCACTGGTGGTGGGCACCGGTGGCCCGGTGC
ATACGGACCGCGATCATCGCATCAAGGTCCAGTTCCATTGGCAGCGCGGCGCGCGCTCGGCCAGCCGGCA
GCCGCATCCGGCCGGCGATGACAACGCCCGCGCGGAGGCCGGCCTGGGCTGCTGGGTGCGCGTGGCGGCG
CCGGTGGCCGGGCCCAACTGGGGTGGCGTGGCGTTGCCGCGCGTGGGCCAGGAAGTGCTGGTGGAATTCG
TGCAGGGCGATATCGACCGGCCGGTGGTGGTGGGCGCGGCCTATAACGGCAGCGGCCAGCGCGACGCGCA
GTACAACCAGAACCAGGCCGGCGCGGCGGGCGCGACCGGCAACGCGCCGGCCTGGTTTGCCGGCGACAGC
AAGAGCCAGGGGGCGTACGCGCACAACGCGGTGCTCTCCGGCATCAAGACGCAGGCGCTGGCCGGCAGCC
AGACGGGCGCCTCGGGCTACAGCCAGCTCGTGTTCGACGATACCGAGTGCCAGGGCCGCACGCAGCTGAG
CACCACCCAGGCCGCCACCGCGCTCACGCTGGGGCACCAGAAGGAACAGATCGACAGCGCCCGCCAGGCC
GACCTAGGACACGGCGCGGCGCTGGCCACCAACGACAGCGGCAGCGTGCGCGCCGGCGCGGGCCTGCTGC
TCACCGCGCACGCCGCCGACACCGGCGCCGCGCTGCTCGACAGCGAAGGCGCCGCCAGCCAGATCGAAGC
CCTCAGCGAACTGGCCGAATCGCTGGCCGACGTGGCCCGGAAGCAGCAGGCCGGCCTGCCGGAAGAGCCT
GCCGCGCAAGACCTGCCCGCGCTCAAGCAACTGCGGCACACCACCGAAGTGCTGCGCCACGCGGAAAGCG
CAGGCAAAGGCGCCTCGGCCATCGCCTACAGCGAACCGCATCTGCAAGTCAGCGCGCCGAAGGGGATTGC
CGCGACCACGCCGGCCGACGCCGTGCTGGTGGCCGGCACCCAGATCGCATTGGCGGCCAAGCAGGACGCC
AACCTCGCTGCGGGCGGCAACCTGGCAATGGCCGTGGCCGACGGCCTGACCCTGTTCGCGCACGGCAAGG
CGGTGGGCCAGTCATCCGACGCGGCCCGGGGCATCGCGATGCATGCGGCGAGCGGCAAGGTGGGCTTGAG
CGCCCTGAAGGGCGAGAGCCGGCTGGTGGCGGAGAAGGCCGTCACGGTGGCATCCACGCAGGGCAATGTC
ACGGCGGAGGGCAAGGCGCGCGTGCTGGTGAATGCGGCAGGCGCGCAGATCCGGGTGACCAACGGGACGA
TTGAGCTGCATGCGCCGGGGAAGACGATCTTCAAGGGGGCGGGGCATGTGTTTGTGGGGCCGGGTGGGGC
AGCGGCGGATAACACGTTGGCTCAGGGCAACCTGAAGGGGTGCGGTATCCAGGAAGGCAACGCCGCTACC
AGTGGAGCCGGGTCGGTTTCGCGTTGA