SecReT6
Protein ID: 525711937
SecReT6 ID819
T6SS typei4b
Gene symbolclpB
Locus tagF504_4472
StrainRalstonia solanacearum FQY_4
Repliconmegaplasmid [GenBank: NC_021745] [Browse all T6SS(s) in this replicon]
Location [Strand]1266834..1269551 [-]
ProductClpB protein
NoteTssH
UniProt IDM4UN28
KEGG IDrse:F504_4472
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.30E-43, Aligned region: 232..311
AAA_2 [PF07724], Evalue: 3.30E-43, Aligned region: 635..802
AAA [PF00004], Evalue: 2.00E-19, Aligned region: 232..344
AAA [PF00004], Evalue: 2.00E-19, Aligned region: 640..758
AAA_5 [PF07728], Evalue: 7.50E-13, Aligned region: 232..253
AAA_5 [PF07728], Evalue: 7.50E-13, Aligned region: 640..758
ClpB_D2-small [PF10431], Evalue: 3.00E-12, Aligned region: 386..403
ClpB_D2-small [PF10431], Evalue: 3.00E-12, Aligned region: 811..886
Clp_N [PF02861], Evalue: 1.30E-10, Aligned region: 23..75
Clp_N [PF02861], Evalue: 1.30E-10, Aligned region: 114..128
AAA_16 [PF13191], Evalue: 3.40E-08, Aligned region: 209..255
AAA_16 [PF13191], Evalue: 3.40E-08, Aligned region: 276..310
AAA_16 [PF13191], Evalue: 3.40E-08, Aligned region: 614..678
AAA_16 [PF13191], Evalue: 3.40E-08, Aligned region: 706..728
AAA_16 [PF13191], Evalue: 3.40E-08, Aligned region: 805..841
AAA_22 [PF13401], Evalue: 3.70E-07, Aligned region: 231..318
AAA_22 [PF13401], Evalue: 3.70E-07, Aligned region: 636..660
AAA_22 [PF13401], Evalue: 3.70E-07, Aligned region: 701..733
Sigma54_activat [PF00158], Evalue: 3.40E-06, Aligned region: 211..248
Sigma54_activat [PF00158], Evalue: 3.40E-06, Aligned region: 637..740
AAA_25 [PF13481], Evalue: 3.70E-06, Aligned region: 226..259
AAA_25 [PF13481], Evalue: 3.70E-06, Aligned region: 288..328
AAA_25 [PF13481], Evalue: 3.70E-06, Aligned region: 634..657
Arch_ATPase [PF01637], Evalue: 2.60E-05, Aligned region: 211..368
Arch_ATPase [PF01637], Evalue: 2.60E-05, Aligned region: 636..676
Arch_ATPase [PF01637], Evalue: 2.60E-05, Aligned region: 710..733
AAA_29 [PF13555], Evalue: 7.20E-05, Aligned region: 224..248
AAA_29 [PF13555], Evalue: 7.20E-05, Aligned region: 635..664
AAA_29 [PF13555], Evalue: 7.20E-05, Aligned region: 732..766
AAA_17 [PF13207], Evalue: 8.30E-05, Aligned region: 232..297
AAA_17 [PF13207], Evalue: 8.30E-05, Aligned region: 639..675
IstB_IS21 [PF01695], Evalue: 0.00014, Aligned region: 225..256
IstB_IS21 [PF01695], Evalue: 0.00014, Aligned region: 639..657
AAA_18 [PF13238], Evalue: 0.0017, Aligned region: 232..252
AAA_18 [PF13238], Evalue: 0.0017, Aligned region: 641..664
NACHT [PF05729], Evalue: 0.0019, Aligned region: 232..318
NACHT [PF05729], Evalue: 0.0019, Aligned region: 427..462
NACHT [PF05729], Evalue: 0.0019, Aligned region: 640..660
T2SE [PF00437], Evalue: 0.0019, Aligned region: 214..249
T2SE [PF00437], Evalue: 0.0019, Aligned region: 623..676
AAA_19 [PF13245], Evalue: 0.0021, Aligned region: 232..258
AAA_19 [PF13245], Evalue: 0.0021, Aligned region: 525..541
AAA_19 [PF13245], Evalue: 0.0021, Aligned region: 635..661
Zeta_toxin [PF06414], Evalue: 0.0023, Aligned region: 232..252
Zeta_toxin [PF06414], Evalue: 0.0023, Aligned region: 631..679
ResIII [PF04851], Evalue: 0.0046, Aligned region: 218..251
ResIII [PF04851], Evalue: 0.0046, Aligned region: 300..314
ResIII [PF04851], Evalue: 0.0046, Aligned region: 443..512
ResIII [PF04851], Evalue: 0.0046, Aligned region: 611..660
AAA_23 [PF13476], Evalue: 0.0063, Aligned region: 232..248
AAA_23 [PF13476], Evalue: 0.0063, Aligned region: 442..492
AAA_23 [PF13476], Evalue: 0.0063, Aligned region: 636..666
Protein Sequence: 905 a.a.     [Download]
>gi|525711937|ref|YP_008238201.1| ClpB protein [Ralstonia solanacearum FQY_4]
MATPLKTLIAKLNATSRQAAERAASLCMARGNYEVDLEHLFLALLENRRSDFAVAARASGIDPAALQRDL
EAEVGRFQTGNTRTPAFSPYLPKLFEHAWLIASLDSQITRIRSGHLLLALLTEPSLAALAERGSRLFGSF
EVERLKHDFERMTTGSDEQEQAVDFADGTAVQTDDGRTAPAAALGATPALDQFTVDLTQAAREGRIDPVI
GRDTEIRQVVDILMRRRQNNPILTGEAGVGKTAVVEGLALRVAANDVPTPLRGVTLRTLDMGLLQAGASV
KGEFENRLKNVIDEVKKSPKPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKK
YFEKDAALARRFQVVKVDEPSEPLAAAMLRGMAPLMERHFGVRVLDEAITEAVRLSHRYISGRQLPDKAV
SVLDTACAKVALGQSATPGAIEDDQKLLERLLGEIAALQREQSAGAAHDARLEALQAKRAELEQRIAQNT
ERLARERALVARIQALREARESDAAQAGAQDAEPVAANSDVVALSPKRARAADAPDELATLLAELRALQG
EAPMVPLQVDGHVVSEIVSAWTGIPLGRMVKDELRTVLNLKPLLAARVIGQDHALDAIAQRVRTASANLE
DPNKPRGVFLFAGPSGVGKTETALALADILYGGERKLITINMSEYQEAHSVSGLKGSPPGYVGYGEGGVL
TEAVRRNPYSVVLLDEVEKAHPDVLEMFFQVFDKGEMDDAEGRPIDFRNTIIILTSNVGSSAIMQACLNQ
PAEALPDADTLAETLRPVLYKAFKPAFLGRTKVVPYYPIADDVLAEIITLKLGRIRDRVAANHKATFQWD
NALVESVLARCTEVDAGARAVDHILNGTLLPEIAEAVLTRMAEGGSVEKIKVSVGKTGEFKYRIN
 
Nucleotide Sequence: 2718 bp     [Download]
>gi|525710956|ref|NC_021745.1|:c1269551-1266834 Ralstonia solanacearum FQY_4 megaplasmid, partial sequence
ATGGCCACCCCACTCAAGACCTTGATCGCCAAGCTGAACGCGACCAGCCGGCAGGCCGCCGAGCGCGCGG
CGTCGCTGTGCATGGCGCGCGGCAACTATGAAGTCGACCTGGAGCACTTGTTCCTGGCGCTGCTCGAAAA
CCGCCGCAGCGATTTCGCCGTCGCGGCGCGCGCCAGCGGCATCGATCCGGCCGCGCTGCAGCGCGACCTG
GAGGCCGAGGTGGGGCGCTTCCAGACCGGCAACACGCGCACGCCGGCGTTCTCGCCGTATCTGCCCAAGC
TGTTCGAGCATGCGTGGCTGATCGCCTCGCTGGATTCGCAGATCACGCGCATCCGCTCGGGCCACCTGCT
GCTCGCGCTGCTGACCGAGCCCAGCCTGGCCGCGCTGGCCGAACGCGGCTCGCGGCTGTTCGGCAGCTTC
GAGGTGGAGCGGCTCAAGCACGATTTCGAGCGCATGACCACCGGCTCCGACGAGCAGGAGCAGGCCGTCG
ATTTCGCCGACGGCACGGCCGTGCAGACGGACGACGGCCGCACCGCGCCCGCCGCCGCGCTGGGCGCGAC
ACCGGCCCTCGACCAGTTCACCGTGGACCTGACGCAGGCTGCCCGCGAAGGCCGCATCGACCCGGTGATC
GGGCGCGACACCGAGATCCGCCAGGTGGTCGACATCCTGATGCGCCGGCGCCAGAACAACCCCATCCTGA
CCGGCGAGGCCGGTGTCGGCAAGACGGCGGTGGTGGAGGGGCTTGCGCTGCGCGTGGCCGCCAACGACGT
GCCGACGCCGCTGCGGGGCGTGACGCTGCGCACGCTCGACATGGGCCTGCTGCAGGCCGGCGCGAGCGTG
AAGGGCGAGTTCGAGAACCGCCTGAAGAACGTGATCGACGAGGTCAAGAAGAGCCCGAAGCCGATCATTC
TGTTCATCGACGAGGCGCACACCATCATCGGCGCGGGCGGGCAGGCCGGGCAGAACGATGCAGCCAATCT
GCTCAAGCCGGCACTGGCGCGCGGTGAGCTGCGCACCATCGCCGCGACCACCTGGAGCGAGTACAAGAAG
TATTTCGAAAAGGACGCCGCTCTCGCGCGCCGCTTCCAGGTCGTCAAGGTCGACGAGCCGAGCGAGCCGC
TGGCCGCGGCCATGCTGCGCGGCATGGCACCGCTGATGGAGCGCCACTTCGGCGTGCGCGTGCTGGACGA
GGCCATCACCGAGGCCGTGCGGCTGTCGCATCGCTACATCAGCGGACGGCAGCTGCCGGACAAGGCGGTC
AGCGTGCTGGATACGGCGTGCGCCAAGGTGGCACTGGGCCAGAGCGCCACGCCGGGCGCCATCGAAGACG
ACCAGAAATTGCTGGAGCGTCTGCTGGGCGAGATCGCCGCGCTGCAGCGCGAGCAGAGCGCCGGCGCGGC
GCACGATGCCCGCCTCGAAGCGCTGCAGGCCAAGCGCGCCGAGCTGGAGCAGCGCATTGCGCAGAACACC
GAGCGCCTGGCCCGGGAGCGTGCGCTGGTCGCGCGCATCCAGGCGCTGCGCGAGGCGCGCGAAAGCGACG
CGGCGCAGGCCGGCGCGCAGGATGCGGAGCCCGTGGCGGCCAACAGCGATGTGGTGGCGCTGTCGCCCAA
GCGCGCCCGTGCCGCCGACGCGCCGGACGAACTGGCCACGCTGCTGGCCGAGCTGCGCGCGCTGCAGGGC
GAGGCGCCCATGGTGCCGCTGCAGGTGGACGGCCATGTCGTGTCGGAGATCGTCTCGGCCTGGACGGGCA
TTCCGCTGGGCCGCATGGTCAAGGACGAGCTGCGCACCGTGCTGAACCTGAAGCCGCTGCTGGCCGCGCG
CGTGATCGGCCAGGACCACGCGCTGGACGCCATCGCCCAGCGCGTGCGCACCGCCTCGGCCAACCTGGAA
GACCCGAACAAGCCGCGCGGCGTGTTCCTGTTCGCGGGCCCGTCGGGTGTGGGCAAGACCGAGACGGCGC
TGGCGCTGGCCGACATCCTCTACGGCGGCGAGCGCAAGCTCATCACCATCAACATGAGCGAGTACCAGGA
GGCGCACAGCGTCTCGGGCCTGAAGGGCTCGCCGCCGGGTTACGTGGGCTACGGCGAGGGCGGTGTGCTG
ACCGAGGCGGTGCGCCGCAACCCGTACAGCGTGGTGCTGCTGGACGAAGTCGAGAAAGCCCACCCCGACG
TGCTGGAGATGTTCTTCCAGGTGTTCGACAAGGGCGAGATGGACGACGCCGAGGGCCGCCCCATCGACTT
CCGCAACACCATCATCATCCTGACCTCGAACGTGGGCTCGTCGGCCATCATGCAGGCCTGCCTGAACCAG
CCCGCCGAGGCGCTGCCCGACGCCGACACCCTGGCCGAGACGCTGCGGCCGGTGCTGTACAAGGCCTTCA
AGCCGGCCTTCCTGGGTCGGACCAAGGTGGTGCCCTACTACCCGATCGCCGACGACGTGCTGGCCGAGAT
CATCACGCTCAAGCTTGGCCGCATCCGCGATCGCGTGGCCGCCAACCACAAGGCGACGTTCCAGTGGGAC
AACGCGCTGGTGGAATCCGTGCTGGCCCGCTGCACCGAAGTGGATGCGGGCGCGCGCGCGGTCGACCACA
TCCTCAACGGCACGCTGCTGCCCGAGATCGCCGAAGCGGTGCTCACGCGCATGGCCGAAGGCGGCAGCGT
CGAGAAGATCAAGGTCAGTGTCGGCAAGACCGGCGAGTTCAAATACCGCATCAACTGA