SecReT6
Protein ID: 525711938
SecReT6 ID819
T6SS typei4b
Gene symbol-
Locus tagF504_4473
StrainRalstonia solanacearum FQY_4
Repliconmegaplasmid [GenBank: NC_021745] [Browse all T6SS(s) in this replicon]
Location [Strand]1269584..1270642 [-]
ProductUncharacterized protein ImpH/VasB
NoteTssG
UniProt IDM4UP65
KEGG IDrse:F504_4473
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.50E-90, Aligned region: 7..333
Protein Sequence: 352 a.a.     [Download]
>gi|525711938|ref|YP_008238202.1| Uncharacterized protein ImpH/VasB [Ralstonia solanacearum FQY_4]
MIRRLLRQPYRYEFFQAVRLLEQLFARRGNAVSEHALATRVSFRNTLSLSFPPSELQAIEAARLTPDMLE
SDAAFIAALEDGVLDTVAITPTFFGMLGVQGALPLRYTEIVAEREAVWRDRAARAFFDIFSNRATALFYL
AWKKYRLPFQYEVDANRHYLPLLLSLAGAADATLRRDLSDTPGPVHDEALAGYATAIRHRPVSAAYLRRV
LADYFRAPMRVEQFVGNWYRVPPSQYSRLGGTNNVLGATALAGARVWQRDLRVRVWVGPLGRAQYRNFLP
GAPGALALRKMLTILCGATLEFEIKLILRRQDVAGCTLGAQDSGRIGWDTFLCSHPAQHDRSDAQYTLAP
LH
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|525710956|ref|NC_021745.1|:c1270642-1269584 Ralstonia solanacearum FQY_4 megaplasmid, partial sequence
GTGATCCGCAGGCTGCTGCGGCAGCCGTACCGGTACGAGTTCTTCCAGGCCGTGCGGCTGCTGGAGCAGC
TGTTCGCGCGCCGGGGCAACGCCGTGTCCGAGCATGCGCTGGCCACGCGCGTGAGTTTCCGCAACACGCT
GTCGCTGTCGTTTCCGCCCAGCGAGCTGCAGGCCATCGAGGCCGCTCGCCTGACGCCCGACATGCTGGAG
AGCGATGCGGCCTTCATTGCGGCGCTCGAGGACGGCGTGCTCGATACCGTGGCCATCACGCCGACCTTCT
TCGGCATGCTGGGCGTCCAGGGGGCGCTGCCGCTGCGCTACACCGAGATCGTCGCCGAGCGTGAGGCCGT
GTGGCGCGACCGTGCCGCGCGGGCCTTCTTCGACATCTTCTCGAACCGCGCGACGGCGCTGTTCTACCTG
GCCTGGAAGAAGTACCGCCTGCCGTTCCAGTACGAGGTCGACGCCAACCGGCATTACCTGCCGCTGTTGC
TGTCGCTGGCCGGCGCCGCAGACGCGACGCTGCGCCGCGATCTATCCGACACGCCGGGGCCGGTCCATGA
CGAGGCGCTGGCCGGCTATGCCACGGCGATCCGGCATCGGCCCGTGTCGGCGGCGTACCTGCGGCGCGTG
CTGGCGGACTACTTCCGGGCGCCGATGCGCGTCGAACAGTTCGTCGGCAACTGGTATCGCGTGCCGCCGT
CGCAGTATTCGCGGCTGGGCGGCACCAACAACGTGCTGGGCGCCACCGCGCTGGCCGGTGCCCGCGTCTG
GCAGCGCGACCTGCGGGTGCGCGTGTGGGTCGGCCCGCTGGGGCGCGCGCAGTACCGCAACTTCCTGCCG
GGCGCGCCCGGCGCGCTGGCACTGCGCAAGATGCTGACGATCCTGTGCGGCGCCACGCTCGAATTCGAAA
TCAAGCTGATCCTGCGGCGTCAGGACGTGGCCGGCTGCACGCTGGGCGCGCAGGACAGCGGCCGGATCGG
TTGGGACACCTTCCTGTGCTCGCATCCGGCGCAGCACGACCGCAGCGACGCGCAATACACCCTCGCACCG
CTGCATTGA