SecReT6
Protein ID: 525711939
SecReT6 ID819
T6SS typei4b
Gene symbol-
Locus tagF504_4474
StrainRalstonia solanacearum FQY_4
Repliconmegaplasmid [GenBank: NC_021745] [Browse all T6SS(s) in this replicon]
Location [Strand]1270639..1272489 [-]
ProductProtein ImpG/VasA
NoteTssF
UniProt IDM4UKV6
KEGG IDrse:F504_4474
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.50E-210, Aligned region: 4..615
Protein Sequence: 616 a.a.     [Download]
>gi|525711939|ref|YP_008238203.1| Protein ImpG/VasA [Ralstonia solanacearum FQY_4]
MEELLPYYERELAFLRRYSRDFAERYPKIAGRLAMSGDGCDDPHVERMIESFALLSARVSKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSVVHFDVRGAAAQLSAPVQIPRGTFLTSRVVRKVECSFRTAYDVTFAPVRI
AAATYARAVSAPSAVSLPKGATGAIALTLEYVGERGGFESLPLDRLRVYMDGEPSFVAALGDALFLHTAG
AYVEGERPGVWTGLSGVPLHEVGFAEDEALIDCPARSHPAYRLLTEHFSFAEKFNFFDIDLAAVRRRLTP
GVPVRRLVLHLVLKDVRSDSHAARLLEGLQAEHLRLHCTPVVNLFQQNADPIRIEHTASAYPVVADSRRA
HGFDIYSIDKVHLVRETAAHEEVTEFRPFYSLHHGEEPGQAGHYWIARRNELVAQRSPGFETEISIVDTR
FDPASPQTDTLSLTVTCTNRDLPSTLAFGQPDGDLSMEGNSVARAITLLRKPTPSMRLGGGRAAQWRLIS
MLSLNHLSLVQNGLPTLKEMLRLHDLPHSAISARQIEGVVGLDYAPATHWLAGKPFATFVRGLEIRLTLD
EDAFVGTGLHRFIRVLDHFFGLYVHINSFVQLIAVSRRSGKELVRCAPRSGESILV
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|525710956|ref|NC_021745.1|:c1272489-1270639 Ralstonia solanacearum FQY_4 megaplasmid, partial sequence
ATGGAAGAGCTGCTGCCCTATTACGAACGAGAACTGGCCTTCCTGCGCCGGTACTCGCGCGATTTCGCCG
AGCGTTATCCGAAGATCGCGGGCCGGCTCGCCATGTCGGGCGACGGCTGCGACGATCCGCACGTCGAGCG
GATGATCGAGTCGTTCGCGCTGCTGAGCGCCCGCGTCAGCAAGAAGCTGGACGACGACTACCCCGAATTC
ACCGAGGCGCTGCTGGAGGTCCTGTACCCCCATTACCTGCGTCCGTTCCCGTCGTGCTCCGTGGTGCATT
TCGATGTGCGCGGCGCGGCGGCCCAGCTCAGCGCGCCGGTGCAGATTCCGCGTGGCACCTTCCTGACCTC
GCGCGTGGTGCGCAAGGTCGAGTGCAGTTTCCGCACCGCTTACGACGTCACCTTCGCGCCGGTGCGGATT
GCCGCGGCCACTTACGCGCGCGCCGTGTCCGCGCCGTCGGCGGTCAGTCTGCCCAAGGGGGCGACCGGTG
CGATCGCGCTGACCCTGGAATACGTTGGCGAGCGCGGCGGCTTCGAGTCCCTGCCGCTCGACCGGCTGCG
CGTCTACATGGACGGCGAGCCGTCGTTCGTGGCCGCGCTGGGGGATGCGCTGTTCCTGCATACCGCGGGA
GCCTACGTGGAGGGCGAGCGACCGGGCGTGTGGACCGGCTTGTCCGGTGTGCCCCTGCATGAGGTCGGCT
TCGCGGAAGACGAGGCGCTGATCGACTGCCCGGCGCGCTCGCATCCGGCCTATCGGTTGCTGACCGAGCA
CTTCAGTTTTGCCGAGAAATTCAATTTCTTCGACATCGACCTGGCAGCCGTGCGGCGCAGGCTGACGCCC
GGCGTGCCGGTTCGCCGCCTGGTGCTGCACCTGGTCCTGAAGGACGTGCGCAGCGACTCGCACGCTGCCC
GCCTGCTCGAAGGCCTGCAGGCCGAACACCTGCGCCTGCATTGCACGCCGGTGGTCAACCTGTTCCAGCA
GAATGCCGATCCGATCCGCATCGAGCACACCGCCAGCGCCTACCCGGTCGTGGCCGACAGCCGACGTGCG
CACGGCTTCGACATCTACTCGATCGACAAGGTGCACCTGGTGCGCGAGACCGCCGCGCACGAAGAGGTGA
CCGAGTTCCGCCCGTTCTACTCGCTGCACCACGGCGAGGAGCCCGGGCAAGCGGGCCACTACTGGATCGC
CCGGCGCAACGAGCTCGTGGCGCAGCGCAGTCCCGGCTTCGAGACCGAGATCTCCATCGTCGATACCCGG
TTCGATCCGGCCAGCCCGCAGACCGACACGCTGAGCCTGACCGTCACCTGCACCAACCGCGATCTGCCGT
CCACGCTGGCGTTCGGCCAGCCGGACGGCGACCTGTCGATGGAAGGCAATTCCGTCGCTCGCGCCATCAC
GTTGCTGCGCAAGCCGACGCCGTCGATGCGCCTGGGCGGCGGCCGCGCGGCGCAGTGGCGGCTGATTTCG
ATGCTCTCGCTCAACCACCTGTCGCTGGTGCAGAACGGGCTGCCGACGCTCAAGGAGATGCTGCGCTTGC
ATGATCTGCCGCATAGCGCCATTTCGGCGCGGCAGATCGAGGGCGTGGTCGGCCTCGACTACGCGCCGGC
CACGCACTGGCTGGCCGGCAAGCCGTTCGCCACGTTTGTGCGGGGGCTGGAGATCCGGCTCACGCTGGAC
GAAGACGCTTTCGTCGGCACGGGCCTGCATCGCTTCATCCGCGTGCTGGACCACTTCTTCGGCCTGTACG
TCCATATCAACAGCTTTGTGCAGCTGATTGCGGTATCGCGCCGCAGCGGCAAGGAACTGGTCAGATGCGC
ACCCCGCAGCGGCGAATCGATCCTGGTGTGA