SecReT6
Protein ID: 525711940
SecReT6 ID819
T6SS typei4b
Gene symbolimpF
Locus tagF504_4475
StrainRalstonia solanacearum FQY_4
Repliconmegaplasmid [GenBank: NC_021745] [Browse all T6SS(s) in this replicon]
Location [Strand]1272552..1273025 [-]
ProductUncharacterized protein ImpF
NoteTssE
UniProt IDM4UL80
KEGG IDrse:F504_4475
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.40E-19, Aligned region: 29..137
Protein Sequence: 157 a.a.     [Download]
>gi|525711940|ref|YP_008238204.1| Uncharacterized protein ImpF [Ralstonia solanacearum FQY_4]
MKGFEPSLLDKLFDDEPHAPMPTALRQLSLEELKSTVARDIESLLNTRIVFEEDDLQSLPECKRSLLTYG
LNDFASLSLASFYDRNYICQSLTKAIERHEPRLQHVSVSLEINERATNALCFGITAVLLVGPAREPVSFD
AMLQPSTLRYSVSRGRG
 
Nucleotide Sequence: 474 bp     [Download]
>gi|525710956|ref|NC_021745.1|:c1273025-1272552 Ralstonia solanacearum FQY_4 megaplasmid, partial sequence
ATGAAAGGTTTCGAACCCAGCCTGCTCGACAAGCTCTTCGACGACGAGCCGCATGCGCCCATGCCGACGG
CTCTGCGGCAGCTTTCGCTGGAAGAGCTCAAGAGCACGGTGGCGCGCGATATCGAGTCCTTGCTCAATAC
GCGCATCGTCTTTGAAGAGGACGACCTGCAGAGCCTGCCCGAATGCAAGCGGTCGCTGCTGACCTACGGG
CTGAACGATTTCGCGAGCCTGAGCCTCGCCAGCTTCTACGACCGCAATTACATCTGCCAGTCGCTCACCA
AGGCGATCGAGCGGCACGAGCCGCGGCTGCAGCACGTCAGTGTCTCGCTTGAAATCAACGAGCGGGCGAC
CAACGCGCTGTGCTTCGGCATCACTGCGGTCTTGCTGGTCGGGCCGGCGCGCGAGCCCGTGAGCTTTGAT
GCGATGCTGCAGCCGTCCACGCTGCGGTATTCCGTCTCGCGCGGGCGCGGCTGA