SecReT6
Protein ID: 525711942
SecReT6 ID819
T6SS typei4b
Gene symbolimpC
Locus tagF504_4477
StrainRalstonia solanacearum FQY_4
Repliconmegaplasmid [GenBank: NC_021745] [Browse all T6SS(s) in this replicon]
Location [Strand]1273678..1275168 [-]
ProductUncharacterized protein ImpC
NoteTssC
UniProt IDM4UN33
KEGG IDrse:F504_4477
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-192, Aligned region: 68..491
Protein Sequence: 496 a.a.     [Download]
>gi|525711942|ref|YP_008238206.1| Uncharacterized protein ImpC [Ralstonia solanacearum FQY_4]
MLDNQSAALAQSAPAAESVNLLDEIVEQSRVAKSDAEHARAKDIIGELVNQVLQGTVVVSDNLSATLDAR
VAELDRLISSQLSAVMHTPEFQKLEGTWRGLSYLVKETQTSTMLKIKVLNATKRDLVRDFKTAIDFDQSA
LFKKVYEEEFGTFGGAPFGTLIGDFEVTRQPEDVYFIEQMSHVAAAAHAPFIASSSPELFGLESFADLGK
PRDLAKVFDTVEYAKWKSFRESEDSRYVGLTMPRFLGRLPYNPKDGTTVEGFNFVEDVDGTDHSKYLWCN
AAWAFGARLTAAFEDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQRPKKYDTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAKNV
ETFLNRWISQYVLLDDNATQEQKAQFPLREASIQVSEVPGKPGTYRSVAFLRPHFQLDELSISLRLVADL
PKPTNS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|525710956|ref|NC_021745.1|:c1275168-1273678 Ralstonia solanacearum FQY_4 megaplasmid, partial sequence
ATGCTTGACAACCAATCCGCCGCGCTCGCGCAGAGCGCACCGGCAGCCGAGTCCGTCAACCTGCTCGACG
AGATCGTCGAGCAGAGCCGCGTCGCCAAGTCGGACGCCGAGCACGCGCGCGCCAAGGACATCATCGGCGA
GCTGGTCAACCAGGTGCTGCAGGGCACGGTGGTGGTGTCCGACAACCTGTCGGCCACGCTGGATGCCCGC
GTGGCCGAGCTGGACCGCCTGATCTCGTCGCAGCTGAGCGCCGTCATGCACACGCCCGAGTTCCAGAAGC
TGGAGGGCACGTGGCGCGGCCTGTCGTACCTGGTCAAGGAAACGCAGACCAGCACGATGCTCAAGATCAA
GGTGCTCAACGCCACCAAGCGCGATCTCGTGCGCGACTTCAAGACGGCCATCGATTTCGACCAGAGCGCG
CTGTTCAAGAAGGTGTACGAAGAAGAATTCGGCACCTTCGGCGGCGCGCCGTTCGGCACGCTGATCGGCG
ATTTCGAAGTCACGCGCCAGCCGGAAGACGTGTACTTCATCGAGCAGATGTCGCACGTGGCGGCGGCCGC
GCATGCGCCGTTCATCGCCTCGTCGTCGCCGGAGCTGTTCGGCCTGGAGTCGTTTGCCGACCTGGGCAAG
CCGCGTGACCTGGCCAAGGTGTTCGATACGGTCGAGTACGCCAAGTGGAAGTCGTTCCGCGAGTCGGAGG
ATTCGCGCTACGTGGGCCTGACGATGCCGCGCTTCCTGGGCCGGCTGCCGTACAACCCCAAGGACGGCAC
CACCGTCGAGGGCTTCAACTTCGTCGAAGACGTGGACGGCACCGACCACAGCAAATACCTGTGGTGCAAC
GCGGCCTGGGCGTTCGGCGCGCGGCTGACCGCCGCATTCGAAGACTTCGGCTGGTGCGCGGCGATCCGCG
GCGTGGAAGGCGGCGGGCTGGTCGAAGACCTGCCGACGCATACCTTCAAGACCGACGACGGCGAAATCGC
GCTCAAGTGCCCGACGGAAATCGCCATCACCGATCGCCGCGAGAAGGAACTGAGCGACCTGGGCTTCATC
CCGCTCGTGCACTGCAAGAACTCGGACTACGCCGCGTTCTTCGCCGCGCAGTCGGTGCAGCGGCCCAAGA
AGTACGACACCGACAGCGCGAATGCCAACGCGGTGCTGTCGGCGCAGCTGCAGTACATCTTCTCGGTATC
GCGCGTGGCGCACTACCTGAAGGCAATGATGCGCGACAAGATCGGCAGCTTTGCGTCGGCCAAGAATGTC
GAGACCTTCCTCAACCGGTGGATTTCGCAGTATGTCCTGCTGGACGACAACGCGACCCAGGAGCAGAAGG
CGCAGTTCCCGCTGCGCGAGGCTTCGATCCAGGTGTCCGAAGTGCCCGGCAAGCCCGGTACGTACCGCTC
GGTGGCGTTCCTGCGGCCGCACTTCCAGCTCGATGAACTGTCGATCTCGCTGCGGCTGGTGGCGGACCTG
CCGAAGCCAACCAATTCCTGA