SecReT6
Protein ID: 525711943
SecReT6 ID819
T6SS typei4b
Gene symbolimpB
Locus tagF504_4478
StrainRalstonia solanacearum FQY_4
Repliconmegaplasmid [GenBank: NC_021745] [Browse all T6SS(s) in this replicon]
Location [Strand]1275161..1275673 [-]
ProductUncharacterized protein ImpB
NoteTssB
UniProt IDM4UP68
KEGG IDrse:F504_4478
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.90E-59, Aligned region: 11..163
Protein Sequence: 170 a.a.     [Download]
>gi|525711943|ref|YP_008238207.1| Uncharacterized protein ImpB [Ralstonia solanacearum FQY_4]
MAKKESVQKRLQKVRPPRVQLTYDVEKGDAIEQKELPFVVGVVADLSGQSEVAQPKLRDRKFVNIDRDNF
DDVMSAAEPRAAFQVQNTLTEEGGRFGVDLKFRSLEDFSPEAVVNQIEPLRQLLEARSKLADLRNKLAGN
DKLEDLLSEVLNNTEALQKLGVKMDGGEDA
 
Nucleotide Sequence: 513 bp     [Download]
>gi|525710956|ref|NC_021745.1|:c1275673-1275161 Ralstonia solanacearum FQY_4 megaplasmid, partial sequence
ATGGCCAAGAAAGAAAGTGTGCAGAAGCGTCTGCAGAAGGTGCGCCCCCCGCGCGTGCAGCTGACGTACG
ACGTTGAAAAGGGCGACGCGATCGAGCAGAAGGAACTGCCGTTCGTGGTCGGCGTGGTGGCGGACCTGTC
GGGCCAGTCGGAAGTGGCGCAGCCCAAGCTGCGCGACCGCAAGTTCGTCAACATCGACCGCGACAACTTC
GACGACGTGATGTCGGCGGCCGAGCCGCGCGCTGCCTTTCAGGTGCAGAACACGCTGACGGAAGAGGGCG
GCCGCTTCGGCGTCGACCTCAAGTTCCGCTCGCTGGAGGATTTCTCGCCGGAAGCCGTGGTGAACCAGAT
CGAGCCGCTGCGCCAGCTGCTGGAGGCACGCTCCAAGCTGGCCGACCTGCGCAACAAGCTGGCCGGCAAC
GATAAGCTGGAAGACCTGCTGTCCGAGGTGCTGAACAACACCGAGGCCCTGCAGAAGCTGGGTGTCAAGA
TGGATGGGGGTGAGGATGCTTGA