SecReT6
Protein ID: 525711945
SecReT6 ID819
T6SS typei4b
Gene symbol-
Locus tagF504_4480
StrainRalstonia solanacearum FQY_4
Repliconmegaplasmid [GenBank: NC_021745] [Browse all T6SS(s) in this replicon]
Location [Strand]1276725..1277306 [+]
ProductType VI secretion lipoprotein/VasD
NoteTssJ
UniProt IDM4UL84
KEGG IDrse:F504_4480
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.40E-37, Aligned region: 4..163
Protein Sequence: 193 a.a.     [Download]
>gi|525711945|ref|YP_008238209.1| Type VI secretion lipoprotein/VasD [Ralstonia solanacearum FQY_4]
MAVIALTACSTGASVLAGAASGALEAVGLKASSVPDAQKPPREVPLKLTAGANLNAATDRRPVALVVRLY
ALKDPTSFLQAPYDTFIDPAREKQTLGADLVQVREMTLIPGQRYEFSEKVSREASTLGVVALFRSPAAQR
WKFAFNAEKSEKSGIMIGLHACAMTLTTGSPTTPAGSAPLSDLNLLSPASCGG
 
Nucleotide Sequence: 582 bp     [Download]
>gi|525710956|ref|NC_021745.1|:1276725-1277306 Ralstonia solanacearum FQY_4 megaplasmid, partial sequence
ATGGCCGTGATCGCCCTGACCGCCTGCTCGACCGGCGCCAGCGTGCTGGCGGGCGCCGCCAGTGGCGCGC
TGGAGGCCGTGGGGCTGAAGGCATCGAGCGTGCCGGACGCGCAGAAACCGCCCCGCGAGGTTCCACTCAA
GCTGACCGCCGGCGCCAACCTGAACGCGGCGACGGACCGCCGCCCGGTCGCGCTGGTGGTCCGGTTATAC
GCACTCAAGGATCCGACCAGTTTCCTGCAAGCGCCGTATGACACGTTTATTGATCCGGCGCGTGAAAAAC
AAACGCTCGGCGCCGATCTGGTCCAGGTCCGGGAAATGACGCTGATTCCCGGCCAGCGCTACGAATTCTC
GGAAAAGGTCTCGCGTGAAGCCAGTACACTGGGCGTTGTTGCTCTATTCCGCAGTCCGGCCGCCCAGCGA
TGGAAATTCGCTTTTAATGCGGAAAAGAGTGAGAAAAGCGGCATCATGATCGGATTGCACGCTTGCGCGA
TGACCCTGACCACGGGCTCGCCGACCACCCCCGCCGGCAGCGCGCCGCTGTCCGACCTGAACCTGCTTTC
GCCGGCAAGCTGCGGCGGCTGA