SecReT6
Protein ID: 525711946
SecReT6 ID819
T6SS typei4b
Gene symbol-
Locus tagF504_4481
StrainRalstonia solanacearum FQY_4
Repliconmegaplasmid [GenBank: NC_021745] [Browse all T6SS(s) in this replicon]
Location [Strand]1277350..1278696 [+]
ProductUncharacterized protein ImpJ/VasE
NoteTssK
UniProt IDM4V2U8
KEGG IDrse:F504_4481
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.50E-133, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|525711946|ref|YP_008238210.1| Uncharacterized protein ImpJ/VasE [Ralstonia solanacearum FQY_4]
MSYSAKILWGEGLFLRPQHFQRQDAYHESRLHATAQMIQPYGWGIRHAQFDTDALASGVLRATELSLFFP
DGELYFAPQADTLPPPLVLDAIPAGVSELTFHLALYPLQDSGGNYREQPEGTTVSRFVSTEAETADLFTE
AESAAITYLKKSVKLVADTEPRDQFIALPIVRVRRTGTGGFELDDSFVAPSLSINASAVLYVRLRRLLDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTANAAFAALSHLYHHPDLHPERLFQEMLRLAGALMT
FTKSYTLADLPAYDHDKPGPVFSRLDTIVRELLDTVISTRYFAIALEETRPSFHLGRIDSGKIDDKTSFY
LSVSADMPAAELVEAIPARFKVGAPDDVDKLVLSSMPGVPLTYTPQVPPAIPVRPGACYFAVEARGMLYE
RMLQAQTITIYAPAGIRELKLELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|525710956|ref|NC_021745.1|:1277350-1278696 Ralstonia solanacearum FQY_4 megaplasmid, partial sequence
GTGAGCTATTCCGCCAAAATCCTCTGGGGCGAAGGGCTGTTCCTGCGGCCCCAGCACTTCCAGCGCCAGG
ACGCGTACCACGAGTCCCGCCTGCATGCGACCGCGCAGATGATCCAGCCGTACGGATGGGGCATCCGCCA
TGCGCAGTTCGACACCGATGCCCTCGCCAGCGGCGTGCTGCGCGCGACCGAGCTGTCGCTGTTCTTTCCG
GACGGCGAGCTGTACTTCGCGCCGCAGGCCGATACCCTGCCGCCGCCGCTCGTGCTCGACGCCATCCCGG
CCGGTGTGTCGGAGCTGACCTTCCACCTCGCGCTCTATCCGCTGCAGGACAGCGGCGGCAACTACCGCGA
GCAGCCCGAGGGCACCACCGTGTCGCGCTTCGTCTCCACCGAAGCAGAAACGGCGGACCTATTCACCGAG
GCCGAGTCCGCGGCCATCACCTACCTCAAGAAGTCGGTGAAGCTGGTGGCGGACACCGAGCCGCGCGACC
AGTTCATCGCGCTGCCCATCGTGCGGGTGCGCCGGACGGGCACCGGCGGCTTCGAGCTGGACGACAGCTT
CGTCGCGCCGAGCCTGTCGATCAATGCGTCCGCCGTGCTGTACGTGCGCCTGCGCCGGCTGCTGGATGCG
CTGCAGGCCAAGGTCAACGCGCTGTACGGCTTCCACCGCGAGCCGACCAAGAACATCATCGAATTCCGCT
CGGGCGATATTGCATCGTTCTGGCTGCTGCACACCGCCAATGCCGCCTTTGCGGCGCTGTCGCACCTCTA
TCACCACCCGGACCTGCATCCGGAGCGGCTGTTCCAGGAGATGCTGCGCCTCGCCGGCGCACTGATGACG
TTCACCAAGAGCTACACCCTGGCCGACCTGCCCGCCTACGACCACGACAAACCCGGCCCGGTGTTCTCGC
GGCTGGACACCATCGTGCGCGAGCTGCTCGATACCGTGATCTCCACGCGCTACTTCGCGATCGCGCTGGA
GGAGACGCGGCCCTCGTTCCATCTCGGCCGGATCGACTCCGGCAAGATCGACGACAAGACCAGCTTCTAC
CTCTCGGTGTCGGCCGACATGCCGGCGGCGGAACTGGTGGAGGCGATTCCCGCGCGCTTCAAGGTCGGCG
CGCCGGACGACGTGGACAAGCTGGTGCTGTCGTCCATGCCGGGCGTGCCGCTCACCTACACGCCGCAGGT
GCCGCCCGCCATTCCGGTGCGGCCGGGCGCGTGCTACTTCGCGGTCGAAGCGCGCGGCATGCTGTACGAA
CGCATGCTGCAGGCCCAGACCATCACCATCTATGCCCCGGCCGGTATCCGGGAACTCAAACTTGAACTCA
TCGCGGTGACTTCATGA