SecReT6
Protein ID: 525711947
SecReT6 ID819
T6SS typei4b
Gene symbol-
Locus tagF504_4482
StrainRalstonia solanacearum FQY_4
Repliconmegaplasmid [GenBank: NC_021745] [Browse all T6SS(s) in this replicon]
Location [Strand]1278693..1279484 [+]
Productputative transmembrane protein
NoteTssL
UniProt IDM4UN38
KEGG IDrse:F504_4482
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.60E-57, Aligned region: 33..234
Protein Sequence: 263 a.a.     [Download]
>gi|525711947|ref|YP_008238211.1| putative transmembrane protein [Ralstonia solanacearum FQY_4]
MSATTTPSLFGGSTAPAGNAAADARESNTHVRTLLDLLYDGFFMLFQLRNGQQPTSAEDFLTRVRAFLED
FDRGAKRLNVSAEDVFDAKYAFCAAVDETILSSNFSIRTAWERRPLQLELFGEQLAGETFFIKLEELRAH
GAPRLQALEVFHMCLLLGFRGKYILEGPEKLAYLTARLGDEISAIKGKRAAFAPHWLLPDKVSHRLKRET
PLWIFGAVFALIALLGYIGLSSTLRAKTNETLEGYSQVIKLGPRFSHLTISLP
 
Nucleotide Sequence: 792 bp     [Download]
>gi|525710956|ref|NC_021745.1|:1278693-1279484 Ralstonia solanacearum FQY_4 megaplasmid, partial sequence
ATGAGCGCTACCACCACGCCTTCGCTGTTCGGCGGCTCGACCGCCCCCGCCGGCAATGCCGCGGCCGATG
CGCGCGAATCCAACACGCACGTGCGCACGCTGCTGGACCTGCTCTACGATGGCTTCTTCATGCTCTTCCA
GCTGCGCAACGGCCAGCAGCCGACCAGCGCGGAAGACTTCCTCACCCGCGTGCGCGCCTTCCTGGAAGAT
TTCGACCGCGGCGCCAAGCGGCTGAACGTGTCGGCCGAAGACGTGTTCGACGCCAAGTACGCGTTCTGCG
CCGCCGTGGACGAGACCATCCTGTCGTCCAACTTCTCCATCCGCACCGCCTGGGAGCGCCGTCCGCTGCA
GCTGGAGCTGTTCGGCGAGCAGCTCGCCGGTGAAACGTTCTTCATCAAGCTGGAAGAGCTGCGTGCCCAC
GGCGCGCCGCGCCTGCAGGCCCTGGAGGTCTTCCACATGTGCCTGCTGCTGGGCTTCCGCGGCAAGTACA
TCCTCGAAGGGCCGGAGAAGCTGGCCTACCTGACCGCCCGCCTGGGCGACGAGATCTCCGCCATCAAGGG
CAAGCGCGCGGCCTTCGCGCCGCACTGGCTGCTGCCGGACAAGGTGTCGCACCGGCTCAAGCGCGAAACG
CCGCTGTGGATCTTCGGCGCGGTCTTCGCGCTGATCGCGCTGCTGGGGTACATCGGCCTGTCGTCCACGC
TGCGCGCGAAGACGAACGAAACGCTGGAAGGCTATTCGCAGGTCATCAAGCTCGGGCCGCGCTTCTCGCA
CCTGACCATCTCGCTGCCCTGA