SecReT6
Protein ID: 525711948
SecReT6 ID819
T6SS typei4b
Gene symbol-
Locus tagF504_4483
StrainRalstonia solanacearum FQY_4
Repliconmegaplasmid [GenBank: NC_021745] [Browse all T6SS(s) in this replicon]
Location [Strand]1279543..1282335 [+]
ProductVgrG protein
NoteTssI
UniProt IDM4UP72
KEGG IDrse:F504_4483
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.50E-64, Aligned region: 46..356
Phage_GPD [PF05954], Evalue: 4.50E-64, Aligned region: 662..771
DUF2345 [PF10106], Evalue: 7.80E-45, Aligned region: 668..818
T6SS_Vgr [PF13296], Evalue: 1.00E-34, Aligned region: 520..628
T6SS_Vgr [PF13296], Evalue: 1.00E-34, Aligned region: 716..736
Phage_base_V [PF04717], Evalue: 8.30E-17, Aligned region: 416..502
Protein Sequence: 930 a.a.     [Download]
>gi|525711948|ref|YP_008238212.1| VgrG protein [Ralstonia solanacearum FQY_4]
MKSPFPLPAAVPQAVLGALLGQQTRQITLETALTSDNLVVERFTAREAVSASCVLQVDCLSPLANLDTAQ
LASQEATLRLMLADGSRRAWHGYVTDCAALGGNGGLARYRLRIGPWLDRLHTRRDCFVYQDKTALEIIED
LFADYPVAHYKLAVSQPCAKRSICCQYRETDYDFVMRLLAEEGLSLRIEHEQGDARRDGSAQSRHCVVIF
DNDAERPACAQPDIRFHRVDATEREDAIERFSQMRTVGTNAVTVSSWNYKALAATAAQASASDPGGELPA
LEAFEAAGPYRFADAQGAGRAARLRMQAHEGAYLRYLGQGSVRQLGPGQRFTLTQHFDTRHSQFVTLSVE
HEAANNLGADLARLLGTTDIESGRYRNRFVAVPAEAPIVPPYRHRPTAPEGQAATVIADDSAPLTTDRDH
RVRIRFPWLRAPALNAFAEPAGSDRSQVTAWVRVATASAGPNWGAHHLPRAGTQALLTFVDGDIDRPLVT
MQLHNEQDALPWPAADAPLGQALSGWHSPSLGGDGYNQWVVDDHPAQLRMRLASSTAGSQLNLGYVVSHG
PTGGERGDWRGTGAELRTDAWAVVRAGGGLLLSTTARAQAGGTLLDMHEARGQLTAAQRTAQRLSDAAAS
QQALPLSANAAFDPLTQALDPAQDGHYPSSVNGQDAVQPNRAPVDKFAQPLLVTESPASIALSSQATTTV
YAGRHLHGTAQGDWHLAAGNVVAAAAAQGVSLFAQRNGLRAIAEGGPVSIQAHTDALAVLADQAVTVTSS
TESIEILAQRNIVLRGGDSVIRMEGSAITFETIKLSVKGAGHPLIGPGGQPAELPGLPSSANQPNWIAMS
LLGYEGQPMRNIQYELAFADGTKRTGRLNGSAEQREEAVPWGEATLTYKNNPAAKDVARPTLDDLLAATE
PLIREEEAKPSSDKTNITTV
 
Nucleotide Sequence: 2793 bp     [Download]
>gi|525710956|ref|NC_021745.1|:1279543-1282335 Ralstonia solanacearum FQY_4 megaplasmid, partial sequence
ATGAAGTCACCGTTCCCCCTGCCGGCCGCCGTGCCGCAAGCCGTCCTGGGCGCGCTGCTCGGGCAGCAGA
CCCGCCAGATCACGCTGGAGACGGCGCTGACCTCCGACAACCTGGTGGTGGAACGCTTCACGGCGCGCGA
GGCGGTGTCGGCATCGTGCGTGCTGCAGGTCGATTGCCTGAGCCCCCTGGCCAACCTGGATACCGCCCAG
TTGGCTTCGCAGGAGGCCACGCTGCGCCTGATGCTCGCCGACGGCAGCCGCCGCGCCTGGCACGGCTACG
TGACCGACTGCGCGGCCCTCGGCGGCAACGGCGGGCTGGCGCGCTACCGCCTGCGCATCGGGCCCTGGCT
CGACCGCCTGCACACCCGCCGCGACTGCTTCGTCTACCAGGACAAGACCGCGCTGGAGATCATCGAAGAC
CTCTTCGCCGATTACCCCGTCGCCCACTACAAGCTTGCCGTCAGCCAGCCGTGCGCCAAGCGCTCGATCT
GCTGCCAGTACCGCGAGACCGACTACGACTTCGTGATGCGCCTGCTGGCCGAGGAAGGCCTGTCGCTGCG
CATCGAGCATGAGCAGGGCGACGCACGGCGCGACGGCAGCGCGCAATCGCGCCACTGCGTGGTCATCTTC
GACAACGACGCCGAACGCCCCGCCTGCGCGCAGCCCGACATCCGCTTCCACCGCGTCGACGCCACCGAGC
GCGAGGACGCCATCGAGCGCTTCTCGCAGATGCGCACGGTCGGCACCAACGCCGTGACCGTCTCCTCGTG
GAACTACAAGGCCCTGGCCGCCACCGCCGCCCAGGCCAGCGCCAGCGACCCCGGCGGCGAACTGCCCGCG
CTCGAAGCGTTCGAGGCCGCCGGCCCCTATCGCTTTGCCGATGCCCAGGGCGCCGGCCGCGCCGCGCGCC
TGCGCATGCAAGCCCACGAGGGCGCCTACCTGCGCTACCTCGGCCAGGGCAGCGTACGCCAGCTCGGCCC
CGGCCAGCGCTTCACGCTCACCCAACACTTCGACACCCGCCACAGCCAATTCGTCACCCTGTCGGTCGAG
CACGAGGCGGCCAACAACCTCGGCGCCGACCTCGCCCGGCTGCTCGGCACCACCGACATCGAATCGGGCC
GCTACCGCAACCGCTTCGTCGCCGTGCCGGCCGAGGCGCCGATCGTGCCCCCGTACCGCCACCGCCCCAC
CGCCCCCGAAGGCCAGGCCGCCACGGTGATCGCCGACGACAGCGCCCCGCTCACCACCGACCGTGACCAC
CGCGTGCGCATCCGCTTCCCGTGGCTGCGCGCGCCGGCGCTCAACGCCTTCGCCGAACCGGCCGGCAGCG
ACCGCTCGCAGGTCACCGCCTGGGTGCGCGTGGCCACCGCCTCGGCCGGCCCGAACTGGGGCGCGCACCA
CCTGCCGCGCGCTGGCACCCAGGCGCTGCTGACCTTCGTCGACGGCGACATCGACCGGCCGCTGGTCACC
ATGCAACTGCACAACGAGCAGGACGCGCTGCCCTGGCCCGCCGCCGATGCGCCGCTCGGGCAGGCGCTGT
CGGGCTGGCACTCGCCGAGCCTGGGCGGCGACGGCTACAACCAGTGGGTGGTCGACGATCACCCCGCGCA
GCTGCGCATGCGGCTGGCCAGCTCCACCGCCGGCAGCCAGCTCAATCTCGGCTACGTGGTCTCGCACGGC
CCGACCGGCGGCGAGCGCGGCGACTGGCGCGGCACCGGCGCCGAACTGCGCACCGATGCGTGGGCGGTGG
TGCGCGCCGGCGGCGGCCTGCTGCTCTCGACCACCGCGCGAGCGCAGGCCGGCGGCACGCTGCTCGATAT
GCATGAGGCGCGCGGCCAACTCACGGCGGCACAGCGCACGGCACAGCGCCTGTCCGACGCGGCGGCCAGC
CAGCAGGCGCTGCCGCTGTCGGCCAATGCGGCCTTCGACCCGCTCACGCAGGCCCTCGACCCCGCCCAGG
ACGGGCACTACCCGAGCAGCGTCAACGGCCAGGACGCGGTTCAGCCGAACCGGGCACCGGTCGACAAGTT
CGCCCAGCCGCTGCTGGTGACCGAATCGCCCGCCAGCATCGCCCTGTCCTCGCAGGCCACCACCACGGTC
TACGCGGGTAGGCACCTGCACGGCACCGCGCAGGGCGACTGGCACCTGGCCGCCGGCAACGTGGTGGCAG
CCGCCGCGGCCCAGGGCGTGAGCCTGTTCGCGCAACGCAACGGCCTGCGCGCCATCGCCGAGGGCGGGCC
GGTCTCGATCCAGGCGCATACCGATGCGCTCGCGGTGCTGGCGGACCAGGCCGTCACCGTGACCTCCTCC
ACCGAGTCGATCGAGATCCTGGCGCAGCGCAACATCGTGCTGCGTGGCGGGGATTCGGTGATCCGGATGG
AGGGCAGCGCGATTACGTTCGAGACGATCAAGCTGAGTGTGAAGGGGGCGGGGCATCCGCTCATCGGGCC
GGGAGGACAACCGGCGGAGTTGCCTGGGTTGCCCTCCTCTGCCAATCAACCGAATTGGATCGCCATGAGC
CTGCTTGGTTACGAGGGGCAGCCAATGCGCAATATCCAATACGAGCTTGCATTCGCCGACGGAACCAAGC
GGACAGGACGGCTGAACGGCTCAGCGGAACAACGCGAAGAAGCCGTGCCATGGGGCGAGGCTACGCTGAC
ATACAAGAACAATCCTGCAGCCAAGGACGTGGCTCGCCCTACGCTGGATGACCTCCTTGCCGCCACCGAG
CCCCTCATCCGCGAAGAAGAAGCAAAACCGAGTTCGGACAAGACGAACATCACCACCGTATGA