SecReT6
Protein ID: 525816134
SecReT6 ID820
T6SS typei3
Gene symbol-
Locus tagSEEH1578_10425
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. 41578
Repliconchromosome [GenBank: NC_021810] [Browse all T6SS(s) in this replicon]
Location [Strand]2106411..2107406 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDS5GSZ8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-94, Aligned region: 10..310
Protein Sequence: 331 a.a.     [Download]
>gi|525816134|ref|YP_008246152.1| type VI secretion protein [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
MTGALDQAQKTPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKFRLGQTPTMTFAPREIAQVSWQDGRLH
LSLYSLGLWGPNGPLPLHYTELALNRSESRHDPTLVHFSNIFHHRWLTQFWQAWRSAQSAGGGLDKPEHD
RFAFYIASLSGQDLRESAESPLSDHVRLAASAHLVRESRNPDGLAATLAHYFSVPFAVKEFALHWITVAN
DEITRLGTPAQSSVLGNGALIGQAVPDMQYKFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIGFEYC
WEIELQLKPHAAPPAVIGGAQRLGWTAWAGKAMHDRPVTGMIFEPEHGLTH
 
Nucleotide Sequence: 996 bp     [Download]
>gi|525814190|ref|NC_021810.1|:c2107406-2106411 Salmonella enterica subsp. enterica serovar Heidelberg str. 41578, complete genome
ATGACCGGCGCTCTCGACCAGGCGCAGAAAACCCCCTGGCGTTACGGATTCCTGAACCTGATGCGGCGCG
TGGATGCCCAGCTCTGTGATACTCCGGCAGGCAGTATCTGGCAGCCACGGATGGAAAAATTCCGTCTGGG
ACAGACGCCGACGATGACCTTTGCGCCACGGGAAATCGCCCAGGTCAGCTGGCAGGATGGACGCCTGCAC
CTGAGCCTGTACAGCCTCGGACTATGGGGGCCAAACGGCCCGTTGCCGCTGCACTATACCGAGCTGGCAC
TGAACCGCTCAGAGAGTCGTCACGATCCGACGCTGGTTCATTTTTCCAATATTTTTCACCACCGCTGGCT
GACGCAGTTCTGGCAGGCATGGCGCAGCGCCCAGTCCGCTGGTGGCGGGCTGGACAAACCGGAACACGAC
CGTTTTGCGTTTTATATCGCCAGTCTCAGCGGGCAGGATCTACGGGAAAGCGCCGAAAGCCCGCTGTCAG
ATCATGTTCGCCTGGCGGCCTCCGCCCATCTGGTACGCGAATCGCGCAATCCTGACGGGCTGGCCGCCAC
GCTGGCACACTATTTCAGCGTACCTTTTGCGGTGAAAGAGTTCGCCCTGCACTGGATAACGGTGGCGAAC
GATGAAATCACCCGTCTGGGCACGCCCGCGCAGTCTTCGGTGCTGGGCAACGGGGCGCTTATCGGCCAGG
CAGTACCGGATATGCAGTACAAATTCCGGCTAATTATCGGCCCGCTCACGCTGGAGGATTACCTGCGTTT
TCTGCCCGGCGGCAACAATCTGCCCGTGCTGACAGAACTGGTGCGTACGTTCATTGGTTTTGAATATTGC
TGGGAAATTGAGCTGCAGTTGAAGCCCCATGCCGCACCGCCTGCGGTGATCGGCGGCGCGCAGCGGCTTG
GCTGGACGGCCTGGGCAGGTAAAGCCATGCATGACCGTCCGGTGACCGGCATGATTTTTGAACCTGAACA
CGGCTTAACCCACTGA