SecReT6
Protein ID: 525816137
SecReT6 ID820
T6SS typei3
Gene symbol-
Locus tagSEEH1578_10440
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. 41578
Repliconchromosome [GenBank: NC_021810] [Browse all T6SS(s) in this replicon]
Location [Strand]2109793..2110617 [-]
ProductProtein of avirulence locus ImpE
NoteTagJ
UniProt IDS5H3A5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 9.10E-46, Aligned region: 143..266
Protein Sequence: 274 a.a.     [Download]
>gi|525816137|ref|YP_008246155.1| Protein of avirulence locus ImpE [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
MKKTDTLPATLSALIQEYSFAEGIQMAEQQVRENPAKALCRHSLFQLLCVAGDWSRALHQLQLCARMEAN
YTQEARLYRELVRCEMFRHTVFQGEQRPGFLLPQPVWVESLLAALACHDDTGEVDKHRNTALEAITDTGG
QWNGGAFDWASDSDSRLGPVLELVTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDTHGAWL
FTRYSGSESASDALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMAHCTFHAQENDGA
 
Nucleotide Sequence: 825 bp     [Download]
>gi|525814190|ref|NC_021810.1|:c2110617-2109793 Salmonella enterica subsp. enterica serovar Heidelberg str. 41578, complete genome
ATGAAAAAAACTGACACGCTTCCTGCTACCCTGTCCGCGCTGATACAGGAATACTCTTTTGCGGAGGGGA
TTCAGATGGCGGAGCAGCAGGTTCGGGAAAATCCGGCGAAAGCGCTCTGCCGCCACAGCCTGTTTCAGTT
GCTGTGTGTGGCCGGAGACTGGTCGCGGGCGCTACACCAGCTTCAGCTATGCGCCAGGATGGAGGCCAAT
TATACCCAGGAGGCCCGGCTGTACCGGGAGCTGGTTCGCTGCGAAATGTTCCGCCACACCGTTTTTCAGG
GTGAACAACGACCCGGTTTTCTTCTGCCGCAGCCCGTTTGGGTGGAGTCACTGCTGGCGGCACTCGCCTG
TCATGACGATACCGGTGAGGTTGATAAACACCGTAATACCGCACTGGAAGCCATAACAGATACTGGCGGA
CAGTGGAACGGCGGCGCATTTGACTGGGCGAGCGACAGCGATTCCCGCCTTGGCCCGGTACTTGAGCTGG
TCACCGGCGGCGTGTATATCTGGCTGCCGTTTTCGCAAATACGCTCGCTGGAATCGCCGCAACCGACGCG
CCTGACCGATCTGCTGTGGAAACCCGTTAATATCACCCTGGTGAATGGCGATACGCACGGCGCCTGGCTC
TTTACCCGTTACAGCGGTTCGGAAAGTGCATCCGACGCCCTGCGTCTGTGCCGGGAAACCGCCTGGCAGG
ACGGCCCCGGCGAAACCACCGTGCGAGCGCTGGGGCAGAAAGTGTGGCTGACCAGCCACGGCGATATCAG
CCTGCTGGACATGGCCCATTGTACCTTTCATGCTCAGGAAAACGATGGCGCATGA